KEGG   Helicobacter pylori F57: HPF57_0137Help
Entry
HPF57_0137        CDS       T01912                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hex  Helicobacter pylori F57
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPF57_0137 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF57_0137 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPF57_0137 (thrC)
Enzymes [BR:hex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPF57_0137 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142934..144394
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLERFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLASALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNDALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERALFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCTSCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKTALETLKNSYNTTDSQRLDDLFEKGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccctacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcgttttgaaacattagaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcgcttg
ggtttagagattcctaagggtttattggcaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccggcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccacgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttgatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgacgctttaaaagcgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttacgggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaatgtggaaagagcgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttatgcattaaagcctaaagaattagccctt
ttgcaggagcatttttcttgcacgagctgctcagatgaagcttgtttgaaaaccatccaa
gaagtttatgccgagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaaccaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccacggatagccagcgccttgatgatttatttgag
aaaggaatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctattcttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system