KEGG   Helicobacter pylori F57: HPF57_0329Help
Entry
HPF57_0329        CDS       T01912                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hex  Helicobacter pylori F57
Pathway
hex00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hex01100  Metabolic pathways
hex01110  Biosynthesis of secondary metabolites
hex01130  Biosynthesis of antibiotics
hex01230  Biosynthesis of amino acids
Module
hex_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF57_0329
Enzymes [BR:hex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPF57_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAJ59403
UniProt: E6NQI7
Position
338186..338746
Genome map
AA seq 186 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECIIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLSVFVETYKKDYTHLKDLGVLGVLEKVPHSQQNQK
KIVFLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctaggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcacagaatgcatcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggaatggtagaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacctacaaaaaagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaacaaaatcaaaaa
aaaatagtttttttagattga

DBGET integrated database retrieval system