KEGG   Helicobacter pylori F57: HPF57_0373Help
Entry
HPF57_0373        CDS       T01912                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hex  Helicobacter pylori F57
Pathway
hex00230  Purine metabolism
hex01100  Metabolic pathways
Module
hex_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPF57_0373 (gmk)
Enzymes [BR:hex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HPF57_0373 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin AAA_16 AAA_17 MMR_HSR1 RNA_helicase RsgA_GTPase ABC_tran ADK AAA_22 AAA_5 dNK AAA_33 Rad17 CPT AAA_29 T2SSE NTPase_1 Podovirus_Gp16 Cytidylate_kin AAA_28 Zeta_toxin TsaE APS_kinase NACHT Mg_chelatase AAA_30
Motif
Other DBs
NCBI-ProteinID: BAJ59447
UniProt: E6NQN1
Position
complement(382040..382660)
Genome map
AA seq 206 aa AA seqDB search
MHNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRKPREGEVDGLHYNFVSEEE
FKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSV
FISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLESFDYLIINEDLEKSKEIILS
IAKTLVYRLKAFNFEKICKAWKNESL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgattttaatttactcatcctttcaggccctagcggagcgggtaaaagcacc
cttacaaagtatttgcaagaaaaaatcccaaaaacccatttttccctttctaccaccaca
cgaaagcctagagagggcgaagtggatggcttgcattataattttgtcagcgaagaggaa
ttcaaacaaggcatagaaaaagggcagtttttagaatgggcgatcgtgcataaccactat
tatggcacttctaaaatccctgtagaaaaagccttaaaagagggcaaaattgtcattttt
gatattgatgtgcaagggcatgagatccttaaaaagcattaccccaacgcatgctctgtg
tttattagcaccaaaaaccaagagattttaaaagagcgcttgcttttaagggggacggat
tctaaagagacgatagaaaagcgcttgatcaacgcttataaggaaatgcagtgcttggag
agctttgattacctcatcatcaatgaagatttagaaaaatccaaagaaatcatcttaagc
atcgcaaaaactttagtctatcgcttaaaagcgtttaattttgaaaaaatatgcaaggct
tggaaaaacgaatccttataa

DBGET integrated database retrieval system