KEGG   Helicobacter pylori F57: HPF57_0531Help
Entry
HPF57_0531        CDS       T01912                                 

Gene name
pldA
Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hex  Helicobacter pylori F57
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPF57_0531 (pldA)
   00565 Ether lipid metabolism
    HPF57_0531 (pldA)
   00590 Arachidonic acid metabolism
    HPF57_0531 (pldA)
   00591 Linoleic acid metabolism
    HPF57_0531 (pldA)
   00592 alpha-Linolenic acid metabolism
    HPF57_0531 (pldA)
Enzymes [BR:hex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPF57_0531 (pldA)
    3.1.1.32  phospholipase A1
     HPF57_0531 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
541456..541764
Genome map
AA seq 102 aa AA seqDB search
MVAYWPYIPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQYWRYDRWHGAFRL
GYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcttattggccctatatcccttatgatcaatccaaccctaatttgattgattac
atggggtatggtaacgctaaagttgattacaggagagggcgccatcattttgaattgcaa
ctttatgatattttcacgcaatactggcgttatgatcgctggcatggggctttccgctta
ggctatacctaccgcattaacccttttgtggggatttatgcgcagtggtttaacggctat
ggcgatggcttgtatgaatacgatgttttttccaatcgtataggggtaggaatacgctta
aacccttaa

DBGET integrated database retrieval system