KEGG   Helicobacter pylori F57: HPF57_0671Help
Entry
HPF57_0671        CDS       T01912                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hex  Helicobacter pylori F57
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hex00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hex00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
704466..705734
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAATLLSQQEVKIKSLPQVVDIKAMALLLQNL
GANLEWLDPNTLQISAKSLRHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEITQLCAFLQSGGVEIEGVGSSELKIRGGENDALNLKDIQIIPDRIEAG
TYLCVGAITNSQLKINRIIPNHLQAITDKLIEIGFSLDIQENSIEIYPAKKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSVIEETLFENRFMHASELQRLGANISLKTNIATISGS
TELTGSDVMATDLRASSALILAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVARLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaagggggggtagaaatttctggg
gcgaaaaactccgcgcttcccattttagccgccacgcttttaagccaacaggaagtcaaa
atcaaatctttaccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggcgctaacttagaatggcttgatcctaacacgcttcaaatcagcgccaaatccttacgc
cacactgaagccacttacgatttggtgcgtaaaatgcgcgcttccattttggttttaggc
ccactattagcgcgttttaaagaatgtttggtgagtttgcccggtgggtgcgctatagga
gcaaggcctgtggatttacacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaagcccctaaaggcttgaaagggaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggcagcaagcttagctaaaggg
atcacacgcatcattaacgctgctaaagagccagaaatcactcaattgtgtgcgttttta
cagagtgggggggtagaaattgagggcgttggcagcagcgagttaaagattagggggggt
gaaaatgatgctttgaatttaaaagacattcagatcatacccgataggattgaagcaggc
acttatttatgcgtgggggctatcactaacagccagcttaaaatcaatcgtatcattcct
aaccatcttcaagcgatcactgataagctcatagaaattggtttttcgctagacattcaa
gaaaattctatagaaatttatccggctaaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccgggctttcccacagacatgcaagcacaattcatggcgttagccacgcagtgc
ttggggacgagcgtgattgaagaaacgctttttgaaaaccgcttcatgcatgcgagcgaa
ttgcagcgcttgggggctaatatcagcctaaaaaccaatatcgctaccattagcggatcc
acagagcttactggaagcgatgtgatggcgaccgatttaagggcttcttcggctctcatt
ttagccgctttagtggctaagggcgtgagtagggtgcataggatttaccacttggatagg
ggttatgagaggttagaggataaaatcaacgccttaggggcaaaagttgcacgcttaaaa
gaaaaataa

DBGET integrated database retrieval system