KEGG   Helicobacter pylori F57: HPF57_1053Help
Entry
HPF57_1053        CDS       T01912                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hex  Helicobacter pylori F57
Brite
Enzymes [BR:hex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HPF57_1053 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 NodS Peptidase_S24 Methyltransf_32 Methyltransf_4 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: BAJ60127
UniProt: E6NSL1
Position
1122603..1123232
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEINKRFNLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDQVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWDQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcaatttgcac
cccaaagtgagagaggctatggagagcattgaaagggaggtttttgtgccagcccctttt
aaacattttgcttacactttaaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcaagtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggtgctgtctcaaatttttaggcgcgtt
tttagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtttaaacaatgttcatgttaaattcgctgatgggaataagggctgggatcaatacgcc
ccctatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgctgattgat
cagcttgaagaaggcgggatattagtcgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcgcgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system