KEGG   Helicobacter pylori F57: HPF57_1065Help
Entry
HPF57_1065        CDS       T01912                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hex  Helicobacter pylori F57
Pathway
hex00010  Glycolysis / Gluconeogenesis
hex00052  Galactose metabolism
hex00500  Starch and sucrose metabolism
hex00520  Amino sugar and nucleotide sugar metabolism
hex00521  Streptomycin biosynthesis
hex01100  Metabolic pathways
hex01110  Biosynthesis of secondary metabolites
hex01120  Microbial metabolism in diverse environments
hex01130  Biosynthesis of antibiotics
hex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF57_1065 (glk)
   00052 Galactose metabolism
    HPF57_1065 (glk)
   00500 Starch and sucrose metabolism
    HPF57_1065 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPF57_1065 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPF57_1065 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPF57_1065 (glk)
Enzymes [BR:hex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPF57_1065 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAJ60139
UniProt: E6NSM3
Position
1134507..1135517
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPTYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLNGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattctatctttctaaatgcaaagaaagccttaaa
ctgcaccctacttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttgaatttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactctcatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatctagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcagaaaggtttttaagcggg
agcggtctggtgctgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtagcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgttccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccggggctt
aatggggcgggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system