KEGG   Helicobacter pylori F57: HPF57_1065Help
Entry
HPF57_1065        CDS       T01912                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hex  Helicobacter pylori F57
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPF57_1065 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF57_1065 (glk)
   00052 Galactose metabolism
    HPF57_1065 (glk)
   00500 Starch and sucrose metabolism
    HPF57_1065 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPF57_1065 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPF57_1065 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPF57_1065 (glk)
Enzymes [BR:hex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPF57_1065 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134507..1135517
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPTYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLNGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattctatctttctaaatgcaaagaaagccttaaa
ctgcaccctacttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttgaatttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactctcatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatctagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcagaaaggtttttaagcggg
agcggtctggtgctgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtagcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgttccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccggggctt
aatggggcgggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system