KEGG   Helicobacter pylori F57: HPF57_1071Help
Entry
HPF57_1071        CDS       T01912                                 

Gene name
porG
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hex  Helicobacter pylori F57
Pathway
hex00010  Glycolysis / Gluconeogenesis
hex00020  Citrate cycle (TCA cycle)
hex00620  Pyruvate metabolism
hex00640  Propanoate metabolism
hex00650  Butanoate metabolism
hex00680  Methane metabolism
hex01100  Metabolic pathways
hex01120  Microbial metabolism in diverse environments
hex01130  Biosynthesis of antibiotics
hex01200  Carbon metabolism
Module
hex_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF57_1071 (porG)
   00020 Citrate cycle (TCA cycle)
    HPF57_1071 (porG)
   00620 Pyruvate metabolism
    HPF57_1071 (porG)
   00640 Propanoate metabolism
    HPF57_1071 (porG)
   00650 Butanoate metabolism
    HPF57_1071 (porG)
  Energy metabolism
   00680 Methane metabolism
    HPF57_1071 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPF57_1071 (porG)
Enzymes [BR:hex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPF57_1071 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: BAJ60145
UniProt: E6NSM9
Position
1141692..1142252
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFSSYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIEAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgctatcactggtgctaaaggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttctcttcctatggttca
gctaaaaggggagctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatcccggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcaccagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaatcgaggcttttaaagaagcttttaagaaa
gttttaggcaaaaagctcactcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttacgaagaagttcaataa

DBGET integrated database retrieval system