KEGG   Helicobacter pylori F57: HPF57_1072Help
Entry
HPF57_1072        CDS       T01912                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hex  Helicobacter pylori F57
Pathway
hex00010  Glycolysis / Gluconeogenesis
hex00020  Citrate cycle (TCA cycle)
hex00620  Pyruvate metabolism
hex00640  Propanoate metabolism
hex00650  Butanoate metabolism
hex00680  Methane metabolism
hex01100  Metabolic pathways
hex01120  Microbial metabolism in diverse environments
hex01130  Biosynthesis of antibiotics
hex01200  Carbon metabolism
Module
hex_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF57_1072 (porD)
   00020 Citrate cycle (TCA cycle)
    HPF57_1072 (porD)
   00620 Pyruvate metabolism
    HPF57_1072 (porD)
   00640 Propanoate metabolism
    HPF57_1072 (porD)
   00650 Butanoate metabolism
    HPF57_1072 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPF57_1072 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPF57_1072 (porD)
Enzymes [BR:hex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPF57_1072 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_8 Fer4_4 Fer4_13 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: BAJ60146
UniProt: E6NSN0
Position
1142268..1142660
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDPASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgtatcaat
tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgatcctgctagtgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system