KEGG   Helicobacter pylori F57: HPF57_1236Help
Entry
HPF57_1236        CDS       T01912                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hex  Helicobacter pylori F57
Pathway
hex00260  Glycine, serine and threonine metabolism
hex00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hex01100  Metabolic pathways
hex01110  Biosynthesis of secondary metabolites
hex01130  Biosynthesis of antibiotics
hex01230  Biosynthesis of amino acids
Module
hex_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF57_1236 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF57_1236 (trpA)
Enzymes [BR:hex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPF57_1236 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: BAJ60310
UniProt: E6NT44
Position
complement(1322617..1323405)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIASGVSALELGLAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASSKDLEQAATHSQGYIYTLARSGV
TGASRILENDASTIIKTLKAFSPTPVLLGFGISKKEHITNAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaaccttaatc
gctagcggggtgagcgctttagagttggggcttgctttttctgatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagctcttaagggcaatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgctagccccaatgcgagcagtaaagat
ttagaacaagccgctacgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggggcgagccgtattttagaaaatgacgcgagcactattattaaaaccctaaaagct
tttagccctacaccggtcttattaggctttggcatttctaaaaaagaacatatcacaaac
gctaaaaacatgggtgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaatgatgaaaacgccatgctggaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system