KEGG   Helicobacter pylori XZ274: MWE_0176Help
Entry
MWE_0176          CDS       T02130                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00260  Glycine, serine and threonine metabolism
hey00750  Vitamin B6 metabolism
hey01100  Metabolic pathways
hey01110  Biosynthesis of secondary metabolites
hey01120  Microbial metabolism in diverse environments
hey01230  Biosynthesis of amino acids
Module
hey_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MWE_0176
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MWE_0176
Enzymes [BR:hey01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MWE_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFJ81137
UniProt: I2DEH1
Position
153210..154670
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLEEKKIDFIEAILNPNAPKGGLYTLEHFETLQWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTSEKTLVSATASYEKFP
STTLLALNEQKKNDNDKTALETLKNSYNTPDSQHLDDLFERGIKHQEVLKLNEIKSSILL
WLESLH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacccgttctttggaagaaaaaaagattgattttattgaagcgata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaacattacaa
tggcaagattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcgcttg
ggtttagagattcctaagggtttattaacaagcgctctaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagaactc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgaggctttaaaagcgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggagcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacttattcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaagttttatgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgttcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgct
agcttgaaaactagtgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agcaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaatactccggatagccagcaccttgatgatttatttgaa
agaggaatcaagcaccaagaagttttaaagctcaatgagatcaaatcttctattcttttg
tggctagaaagcctacattaa

DBGET integrated database retrieval system