KEGG   Helicobacter pylori XZ274: MWE_0354Help
Entry
MWE_0354          CDS       T02130                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hey01100  Metabolic pathways
hey01110  Biosynthesis of secondary metabolites
hey01130  Biosynthesis of antibiotics
hey01230  Biosynthesis of amino acids
Module
hey_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MWE_0354
Enzymes [BR:hey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MWE_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFJ81281
UniProt: I2DEW5
Position
306937..307497
Genome map
AA seq 186 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVVLDEELLKEDLKGMVEFAWRLGLSVFVETRKPDYTHLKDLGVLGVLEKVPHSQQNQK
KIVFLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcacagaatgtgtcattgtcaatttcaaaggattatacgaaataggtgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagatgaagagcttttgaaagaggatttaaagggaatggtggaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacccgcaagccagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaacaaaatcaaaaa
aaaatagtttttttagattga

DBGET integrated database retrieval system