KEGG   Helicobacter pylori XZ274: MWE_0354Help
Entry
MWE_0354          CDS       T02130                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hey  Helicobacter pylori XZ274
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MWE_0354
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MWE_0354
Enzymes [BR:hey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MWE_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306937..307497
Genome map
AA seq 186 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVVLDEELLKEDLKGMVEFAWRLGLSVFVETRKPDYTHLKDLGVLGVLEKVPHSQQNQK
KIVFLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcacagaatgtgtcattgtcaatttcaaaggattatacgaaataggtgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagatgaagagcttttgaaagaggatttaaagggaatggtggaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacccgcaagccagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaacaaaatcaaaaa
aaaatagtttttttagattga

  All links  
No link information was found.   
DBGET integrated database retrieval system