KEGG   Helicobacter pylori XZ274: MWE_0495Help
Entry
MWE_0495          CDS       T02130                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hey  Helicobacter pylori XZ274
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hey00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441045..441536
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
VYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIAFNQVILRQKDLTLPHLKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggctgggatctaaccttaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaatcgggaaaattttttcttcgcct
gtttatatcaacccgccttttggttacacgaagcaacctaacttttataacgctacgatt
atccttaaaacatctttaagtttgcgccatttttttgctctggttttttatatagaaagg
cgttttgggcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaatcaagtcattttaagacagaaggatttgactttacctcatcttaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system