KEGG   Helicobacter pylori XZ274: MWE_1270Help
Entry
MWE_1270          CDS       T02130                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hey  Helicobacter pylori XZ274
Brite
Enzymes [BR:hey01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MWE_1270 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153740..1154369
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEINKRFNLHHKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWEQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALCVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcaatttgcac
cacaaagtgagagaggctatggagagcattgaaagggaggtttttgtgccagcccccttt
aaacattttgcttacactttaaacgcgctttccatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggttttgtctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtttaaacaatgttcatgttaaattcgctgacgggaataaaggctgggagcaatacgcc
ccctatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgctcattgat
cagcttgaagaaggcgggatattagtcgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgtgcgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system