KEGG   Helicobacter pylori XZ274: MWE_1283Help
Entry
MWE_1283          CDS       T02130                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hey  Helicobacter pylori XZ274
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MWE_1283 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MWE_1283 (glk)
   00052 Galactose metabolism
    MWE_1283 (glk)
   00500 Starch and sucrose metabolism
    MWE_1283 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MWE_1283 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MWE_1283 (glk)
   00524 Butirosin and neomycin biosynthesis
    MWE_1283 (glk)
Enzymes [BR:hey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MWE_1283 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1165651..1166661
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVTPRQIECIEVLPCKDFESLSDAVRFYLSKCKEILK
LRPMYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcaccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattttatctttctaaatgcaaagaaatccttaaa
ctgcgccctatgtatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgactaacaaccattggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgttatcaatgattttgtcgcgcaagcctatgccattagtgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgatggttctttaaaa
gtcttgcccggtgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagtgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatcccg
cgattcattgattattttaaaacttcgccctttagagcacgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
gatggggcgggcattgcattagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system