KEGG   Helicobacter pylori XZ274: MWE_1290Help
Entry
MWE_1290          CDS       T02130                                 

Definition
porC, porG
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hey  Helicobacter pylori XZ274
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MWE_1290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MWE_1290
   00020 Citrate cycle (TCA cycle)
    MWE_1290
   00620 Pyruvate metabolism
    MWE_1290
   00640 Propanoate metabolism
    MWE_1290
   00650 Butanoate metabolism
    MWE_1290
  Energy metabolism
   00680 Methane metabolism
    MWE_1290
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MWE_1290
Enzymes [BR:hey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MWE_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1172828..1173388
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTIYIITSYLNKEGLFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcgcgagctggtcaaggcgcaatcactggcgctaaaggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatcccggtttggttttcatt
gaaaacatcttcgccaatgaaaaagaagacacgatctatatcatcactagctatcttaac
aaagaaggattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaagatctctatggaaaccttaaaacgccctatccccaacacgcccatgctaggg
gctttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system