KEGG   Helicobacter pylori XZ274: MWE_1486Help
Entry
MWE_1486          CDS       T02130                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hey  Helicobacter pylori XZ274
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hey01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hey00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hey00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1352723..1353511)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIASGVSALELGFAFSDPVADG
ITIQASHLRALKHATMEKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKYQIKQIFIASPNASDKDLEQAATHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHTINAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaaccttaatc
gctagtggggtgagcgctttagaattggggtttgctttctccgatccggtagcggatggc
attaccatacaagcgagccatttaagagcgttaaaacatgctactatggaaaaaaatttc
cagctcttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaataccagattaaacaaatctttatcgccagccctaatgcgagtgataaagat
ttagaacaagccgctacgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggggcgagccgtattttagaaaatgatgcgagcgctattattaaaaccctaaaaact
tttagccctactccagccttattaggctttggcatttctaaaaaagaacacaccataaac
gctaaaaacatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctagaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system