KEGG   Helicobacter pylori XZ274: MWE_1623Help
Entry
MWE_1623          CDS       T02130                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hey  Helicobacter pylori XZ274
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hey00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1464139..1464942
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKTKNVSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLQTYDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGDE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttaccataagctcatttctcgcatgtgtttggtcaaagataaattaaaggatatt
atcagcgtcaaaagcgcgctttccttttcactaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaaacaaaaaatgtc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttgggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggt
gcagacaccaactttttcatctcgcaacacaaaagcgctaacgctacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcgccaaac
catgttttttgcagcaccaaagccatttatcaagcctataaacctgaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgcctacagacttatgatagaaac
gaattaaacgatcttttaaaaccggctttactcactaaccaagccttaaggggtatagaa
agcgaactgggcaaggagtggttttttagcggaagcgggagcgcgttttttaggctaaag
cctgcgttaaaaggggacgaatga

DBGET integrated database retrieval system