KEGG   Helicobacter pylori BM012S: U064_0998Help
Entry
U064_0998         CDS       T02940                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hez  Helicobacter pylori BM012S
Pathway
hez00071  Fatty acid degradation
hez00072  Synthesis and degradation of ketone bodies
hez00280  Valine, leucine and isoleucine degradation
hez00310  Lysine degradation
hez00362  Benzoate degradation
hez00380  Tryptophan metabolism
hez00620  Pyruvate metabolism
hez00630  Glyoxylate and dicarboxylate metabolism
hez00640  Propanoate metabolism
hez00650  Butanoate metabolism
hez00900  Terpenoid backbone biosynthesis
hez01100  Metabolic pathways
hez01110  Biosynthesis of secondary metabolites
hez01120  Microbial metabolism in diverse environments
hez01130  Biosynthesis of antibiotics
hez01200  Carbon metabolism
hez01212  Fatty acid metabolism
hez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hez00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    U064_0998
   00630 Glyoxylate and dicarboxylate metabolism
    U064_0998
   00640 Propanoate metabolism
    U064_0998
   00650 Butanoate metabolism
    U064_0998
  Lipid metabolism
   00071 Fatty acid degradation
    U064_0998
   00072 Synthesis and degradation of ketone bodies
    U064_0998
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U064_0998
   00310 Lysine degradation
    U064_0998
   00380 Tryptophan metabolism
    U064_0998
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U064_0998
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U064_0998
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    U064_0998
Enzymes [BR:hez01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U064_0998
Exosome [BR:hez04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U064_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHA89913
UniProt: V5NP09
Position
1016189..1017364
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVYVLKDALNASSLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGHDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQALGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKKSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgtttatgtgcttaaagatgctttgaatgcg
agctctcttaagcctagcgatgtggattccgtcattttaggcaatgttttaggcgccggt
ttgggtcaaaatatcgctaggcagatccaactagacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagctatccagttagcgcatgac
agcatcatgcttgggcacgatgaggtggtggtgtgcggtggcgtggagaacatgagtgca
gcgccctatctgtcgtttgatatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgatggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcggggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacactagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcagta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
aaaaaagcgcaagcattggggttaaaaaccatggccactattaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgagctcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgagttaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatcttagtaacttta
ttgcatgaaatgaagaaaagcggtcatggcgtgggctgcgcgtcattgtgtgtgggcggc
gggcaaggtctttctgtggtagttgaacaaaaataa

DBGET integrated database retrieval system