KEGG   Helicobacter felis: HFELIS_01970Help
Entry
HFELIS_01970      CDS       T01375                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hfe  Helicobacter felis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFELIS_01970 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFELIS_01970 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HFELIS_01970 (trpB)
Enzymes [BR:hfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HFELIS_01970 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
165620..166816
Genome map
AA seq 398 aa AA seqDB search
MDRYFGEFGGAFVPELLVPALEQLEQAFEDCLQDSEFQATFNNLLTDFVGRPSPLTLVKN
FCPNPKVKMYLKREDLIHGGAHKTNQALGQALLAKQMGKRRVIAETGAGQHGVATAIACA
LLGLECVIYMGEKDIQRQEPNVFRMRLLGAQVVGVQSGSASLKDAINEALRDWASSYPST
HYLLGTAAGPHPYPRMVKHFQSVIGTEAKAQILEKEGRLPDSVIACVGGGSNAIGIFAGF
LEDKSVGLIGVEPGGLGLDTHKHGATLCKGSVGILHGCKSYILQDEEGQIIESHSISAGL
DYPGVGPEHSYLKQSGRAEYVAISDQEALEAFVHLSQSEGIIPALESAHALAYAHKLAQE
CQKETLMLVNLSGRGDKDLASVQGILRGGGGGKLKNLC
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttattttggagagtttggaggggcttttgtgcccgagttattagtgcccgcc
ttagagcagttagaacaggcgtttgaagattgcctgcaagattcagagttccaagccaca
tttaataaccttttaacagattttgtagggcggcctagtcctctaactttagtgaaaaat
ttttgccctaatcctaaggtaaaaatgtatctcaagcgcgaggatttgatccatgggggg
gcgcacaagactaatcaagccttagggcaggcgttactggctaaacaaatgggcaaaagg
cgtgtgatcgctgaaacgggcgcaggacagcacggagtagccacagcgatcgcctgcgcg
ttgttagggttagaatgtgtgatttacatgggagaaaaggacatacaacgccaagagcct
aatgtttttcgcatgcgcttattgggcgcgcaagtggtgggtgtgcaaagtggaagcgca
agcttgaaggatgcaatcaatgaagccttgagagattgggcgagttcttatcctagcacg
cattatctactaggcacagcagccgggccccacccctacccgcgcatggtcaaacacttt
caaagcgtgatcggcacggaggcaaaagcgcaaattttagaaaaagagggcagattgcct
gatagcgtgatcgcgtgcgtgggtgggggctcaaatgcgattgggatttttgccggattt
ttggaggataaaagcgtggggctaataggggttgaacccggagggttagggttagacacg
cacaaacacggagcgactttgtgtaagggcagtgtggggattttacacgggtgtaagagt
tatattttacaagatgaggaagggcagataatagagagtcatagtatctctgctgggcta
gattatccgggtgtggggcctgagcatagctatttaaaacagagtgggcgcgcggagtat
gtggctattagtgatcaggaagccttagaggcgtttgtgcatttaagccaaagcgagggg
attattccggctttagagagcgcgcatgcgctagcttatgcgcacaaactcgctcaagaa
tgccaaaaagaaacgcttatgctggtgaatttgagcgggcgcggagataaggacttagcc
agtgtgcaggggattttgcggggggggggggggggtaagttaaaaaatttgtgctag

DBGET integrated database retrieval system