KEGG   Helicobacter felis: HFELIS_02100Help
Entry
HFELIS_02100      CDS       T01375                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hfe  Helicobacter felis
Pathway
hfe00260  Glycine, serine and threonine metabolism
hfe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hfe01100  Metabolic pathways
hfe01110  Biosynthesis of secondary metabolites
hfe01130  Biosynthesis of antibiotics
hfe01230  Biosynthesis of amino acids
Module
hfe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFELIS_02100 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HFELIS_02100 (trpA)
Enzymes [BR:hfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HFELIS_02100 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG IMPDH NMO FMN_dh
Motif
Other DBs
NCBI-ProteinID: CBY82294
UniProt: E7AD29
Position
178750..179526
Genome map
AA seq 258 aa AA seqDB search
MFEKRGVFVPFVMLGDPSYEVSFEIIKTLIDAGVDALELGFAFSEPMADGPTIQASHLRA
LKGGVNMRTNFALLEKVRAYAPNIPIGLLLYANLVHHFGVDHFYRACAQSGVDSVLVADV
PLTESAPFVQSANQHHIAPIFIAAPHTSSAHLRQIVTQSLAYVYVLARAGVTGASQTLGQ
EAREVIVHLKELAPLPCLLGFGISQPGHIQEALALGADGVICGSAIVKIIEEGLKDSSWM
LKNLRVFVENMRMGLCYN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaaaggggcgtttttgtgccctttgtgatgttgggcgatcctagttatgag
gtgagttttgagatcattaagactcttattgatgcaggggtggatgccttagaattgggt
tttgccttttctgaaccgatggctgatggccccaccattcaggcaagccatcttagagct
cttaagggcggggtgaatatgcgcactaattttgctctcttagaaaaggtgcgcgcctat
gccccaaatattcccatcggacttttgctttatgctaatttggtgcaccactttggggtg
gatcatttttatcgcgcttgtgcacagagtggagtagatagcgtgttggtggctgatgtg
cctttaacagagagtgcgccctttgtgcaaagcgcaaaccaacaccatatcgccccgatt
tttattgctgccccacacacaagttcggcgcatttaagacagatcgttacacagagttta
gcttatgtctatgtgttggcgcgcgcaggagttactggagctagtcaaactctaggccaa
gaggctagagaagtgattgtccatcttaaagagctcgcacctctgccttgtctgctaggc
tttggcatttctcagcctggccacatacaagaggcgttagcattgggcgcagatggggtg
atttgtggttcagccattgtaaaaattatagaagaagggctcaaagattcctcttggatg
ttaaaaaatttgcgcgtttttgtagaaaatatgcgtatggggttgtgctataattag

DBGET integrated database retrieval system