KEGG   Helicobacter felis: HFELIS_02100Help
Entry
HFELIS_02100      CDS       T01375                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hfe  Helicobacter felis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFELIS_02100 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFELIS_02100 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HFELIS_02100 (trpA)
Enzymes [BR:hfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HFELIS_02100 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
178750..179526
Genome map
AA seq 258 aa AA seqDB search
MFEKRGVFVPFVMLGDPSYEVSFEIIKTLIDAGVDALELGFAFSEPMADGPTIQASHLRA
LKGGVNMRTNFALLEKVRAYAPNIPIGLLLYANLVHHFGVDHFYRACAQSGVDSVLVADV
PLTESAPFVQSANQHHIAPIFIAAPHTSSAHLRQIVTQSLAYVYVLARAGVTGASQTLGQ
EAREVIVHLKELAPLPCLLGFGISQPGHIQEALALGADGVICGSAIVKIIEEGLKDSSWM
LKNLRVFVENMRMGLCYN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaaaggggcgtttttgtgccctttgtgatgttgggcgatcctagttatgag
gtgagttttgagatcattaagactcttattgatgcaggggtggatgccttagaattgggt
tttgccttttctgaaccgatggctgatggccccaccattcaggcaagccatcttagagct
cttaagggcggggtgaatatgcgcactaattttgctctcttagaaaaggtgcgcgcctat
gccccaaatattcccatcggacttttgctttatgctaatttggtgcaccactttggggtg
gatcatttttatcgcgcttgtgcacagagtggagtagatagcgtgttggtggctgatgtg
cctttaacagagagtgcgccctttgtgcaaagcgcaaaccaacaccatatcgccccgatt
tttattgctgccccacacacaagttcggcgcatttaagacagatcgttacacagagttta
gcttatgtctatgtgttggcgcgcgcaggagttactggagctagtcaaactctaggccaa
gaggctagagaagtgattgtccatcttaaagagctcgcacctctgccttgtctgctaggc
tttggcatttctcagcctggccacatacaagaggcgttagcattgggcgcagatggggtg
atttgtggttcagccattgtaaaaattatagaagaagggctcaaagattcctcttggatg
ttaaaaaatttgcgcgtttttgtagaaaatatgcgtatggggttgtgctataattag

DBGET integrated database retrieval system