KEGG   Helicobacter felis: HFELIS_03440Help
Entry
HFELIS_03440      CDS       T01375                                 

Definition
putative cytochrome C551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hfe  Helicobacter felis
Brite
Enzymes [BR:hfe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HFELIS_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311156..312295
Genome map
AA seq 379 aa AA seqDB search
MKIKNLFKVSFMSVGLCAALYAKPSHHTISAQELIKKALDANLMPMPTGKVLDKYLKDKV
RDLGLSYKGAVLTKAQIELGKMLYLDPRISTSYLISCNTCHNLGMAGVDTVSRAVGEGWK
PNPHFLNSPTVYNSVFNAVQFWDGRVAHLDDQAKGPISNPVEMNADPKVVEAKINSMPGY
VKAFKRAYGNNVKIDLNLITDTIAMFEATLNTPSRFDDFLRGNVKALSPKEQEGLSLFLE
KGCAGCHNGINLGGTMQPFQVAAPYEFANVGDFKGDKNGMVKVPTLRNILETMPYFHNGQ
YWNVKDAIKAMGAVQLGIQISDSDAQKIAVFFGALTGKKPTITYPQLPTIANNTPKPEGI
MEQESQSAKPSKSTKSTTH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaaaatttgttcaaagtgtcttttatgtctgtaggtctgtgcgctgccctt
tatgctaagccaagccaccataccataagtgcgcaagaattgattaagaaagccctagac
gctaatcttatgcccatgccaacaggcaaggttttagataaatatctcaaagataaggtg
cgcgacttaggtctttcttataagggtgctgtgctcactaaggcgcaaattgagttagga
aaaatgctctacctagaccctagaatttctacttcttatcttatttcttgcaacacatgc
cataacttaggcatggcaggggtagatactgtatcacgagctgtaggagagggctggaaa
cctaacccccattttttaaattcccccaccgtgtataattccgtctttaatgcggtgcag
ttttgggatgggcgtgtggcacacctagacgatcaggctaaaggccccatcagcaacccg
gtagaaatgaatgccgatcctaaagttgtggaagctaagatcaattctatgcccggctat
gtcaaagcctttaaacgcgcctatggcaacaatgttaaaatcgatcttaacttgatcaca
gatacgattgctatgtttgaagccacactcaacacccctagccgttttgacgactttttg
cggggcaatgtcaaagcactaagtcctaaagaacaagagggcttgtctttattcctagaa
aagggctgtgcaggttgccacaatggaatcaacttaggaggcactatgcaacctttccaa
gtggctgccccttatgaatttgccaatgtgggggatttcaagggagataaaaacggcatg
gtcaaagtgcctaccttgcgcaatatcttagaaaccatgccctatttccataatggacaa
tattggaatgtcaaggatgcgatcaaggccatgggtgctgtacaactaggaatccaaatc
agtgatagcgatgcgcaaaaaatcgctgtcttctttggtgctctcacgggtaaaaaacct
accatcacctaccctcaattacccaccatcgctaacaacacccctaaacctgagggcatt
atggagcaagagagtcaatcggctaaacctagcaaatctaccaaatccaccacccactaa

DBGET integrated database retrieval system