KEGG   Helicobacter felis: HFELIS_04130Help
Entry
HFELIS_04130      CDS       T01375                                 

Gene name
folP
Definition
putative dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hfe  Helicobacter felis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HFELIS_04130 (folP)
Enzymes [BR:hfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HFELIS_04130 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
384884..386035
Genome map
AA seq 383 aa AA seqDB search
MFLERIAPASFALELERITPHPVGQAIMSQKARLFAFKISDLPLSAALTLKQEALRVGAE
LATPKDCILAKKPAYTCLLVGTYDQLERLRVKCTSQAFGLKRLAKMLESHLQSPSFDNPA
LMGIINITPDSFYPQSRHNVQQALEKIYHYLEQKIAYIDIGAASSRPFSARLEAHEEIAR
LKDICAEIKTHNLTQHAIFSIDTYNPKTADFALRHGFQLLNDVNGFREELMCQVAKAYGV
QVVLMHSNGVPMDMDHFAPHKQLFLEMDRFFEMQLERLDQYEISNILLDIGLGFNKTTAQ
NLALIQHLEHFLHFGYPLLVGASRKKCIGEICAREVQDRLSGTLALHLVALQRGASILRV
HDIAPHQDLLKIYKALCEVELPY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgtttttagaacgcatcgctccggctagttttgccctagaattagagcgcatcactccc
cacccagttggtcaagctattatgagccaaaaagcccgactcttcgcttttaaaattagc
gatttacccttgagtgctgcactcacactcaagcaagaagccctgcgcgtgggagctgaa
ttagcgacacctaaggattgcattttggctaagaaacctgcctacacatgtcttttagtg
ggcacttacgaccaactagaacgcttgcgcgtgaaatgcacttctcaagcctttggatta
aaaagattggcaaagatgctagagtcccatctgcaatctccatcttttgacaatccagct
ctgatgggtattatcaatatcactccggatagtttttacccacagagtcggcacaatgtc
cagcaagctttagaaaaaatttatcactatttagaacaaaaaatcgcctatattgatatt
ggggcagccagctcacgcccctttagcgcacgccttgaagcacatgaagaaatcgcacgc
ctcaaagacatttgtgcagaaatcaaaacccacaacctaacccaacacgccatttttagc
atagatacttataatcccaagacagccgattttgctctgcggcacggttttcaattactc
aacgatgtcaatggttttagagaagagttaatgtgtcaagtggctaaagcttatggagtt
caagttgtgctgatgcattctaacggggtgcctatggatatggatcattttgcgccccac
aagcaactttttttggagatggatcgcttttttgagatgcaattagagcgtttggatcaa
tatgaaattagcaatattctcttagatattggtctaggctttaacaaaaccactgcgcag
aacttggcccttatccagcacttagagcattttttgcattttggttatcccttacttgtg
ggcgcaagccgtaaaaaatgtattggcgagatttgcgctagagaggtgcaagatcgctta
agtggcactttggctttgcacttggttgctttgcaaagaggggcgagcattctacgcgtg
cacgacattgccccccatcaagacttgctaaaaatctacaaggctctttgtgaagtggag
ttaccatactaa

DBGET integrated database retrieval system