KEGG   Helicobacter felis: HFELIS_04950Help
Entry
HFELIS_04950      CDS       T01375                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hfe  Helicobacter felis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFELIS_04950 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFELIS_04950 (glk)
   00052 Galactose metabolism
    HFELIS_04950 (glk)
   00500 Starch and sucrose metabolism
    HFELIS_04950 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HFELIS_04950 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HFELIS_04950 (glk)
   00524 Butirosin and neomycin biosynthesis
    HFELIS_04950 (glk)
Enzymes [BR:hfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HFELIS_04950 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471606..472595
Genome map
AA seq 329 aa AA seqDB search
MSSTPDKTYPRLLADIGGTNARFGLEVAPDKIESIEVLACQDYNTVVDAIKAYLAKVNNP
SVKYAAIAIANPVMGDWVQMTNHHWAFSIETTRQALKLEVLILINDFTAQAHAISKIDPE
ELLQVGGNVCGIDAPKVVLGPGTGLGVSALIPCCDGSYTALAGEGGHVSFAPFDDTEIMI
WQYARKKYGHVSAERFLSGAGLVLIHAALADREGIKISKMTPELISQQALSGKSPLCRLT
LDIFCTILGTVASNMALILGARGGVYLCGGIIPRFIDYFKTSPFRLRFENKGRFAAYLAA
IPVYVVLSQYPGIKGVAVALDNHLKVKTI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgcccgataaaacttacccccgtctgctcgccgacattggaggcacgaac
gcgcgctttggcctagaagtcgccccggataaaatcgaatccattgaggttttggcttgt
caggactataacaccgtggtagatgcgatcaaggcgtatttggctaaagtcaataacccc
tctgtgaaatacgcagccattgccatcgctaaccccgtgatgggcgattgggtgcagatg
accaaccaccactgggcgttttccatcgaaaccacccgccaagccctcaaattggaagta
ttgattttgatcaatgactttaccgctcaagcccatgccatttctaaaatcgaccccgaa
gagttgctacaggtaggggggaatgtgtgcgggatcgacgcgcctaaggtggttttagga
ccgggcacgggattaggggtgagcgcgctcattccctgctgtgatggctcttacacagcc
ttagcgggcgagggtgggcatgtgagttttgcgccctttgatgacaccgagattatgatc
tggcagtatgcgcgcaaaaaatacgggcatgtgtctgccgagcgttttttaagtggggca
ggcttggtgctcatccatgccgctttggctgatcgtgaggggattaaaattagcaagatg
acccctgagctcatcagccagcaggccctgagtggcaaatcccccctatgccgtttgact
ttggatattttttgcaccattttaggcacggtggcctctaacatggctttgattttgggc
gcgcgcgggggggtgtatttgtgtggggggattatcccacgcttcattgattattttaaa
acctcgcccttccgcttgcgctttgaaaataaggggcgttttgcggcgtatttggcagct
attccggtgtatgtggtgctatctcagtatcccggaatcaagggtgtagctgtcgcccta
gacaaccatctaaaggtcaaaacaatctga

DBGET integrated database retrieval system