KEGG   Helicobacter felis: HFELIS_05870Help
Entry
HFELIS_05870      CDS       T01375                                 

Gene name
atoB2
Definition
(GenBank) acetyl-CoA acetyltransferase 2
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hfe  Helicobacter felis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HFELIS_05870 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    HFELIS_05870 (atoB2)
   00640 Propanoate metabolism
    HFELIS_05870 (atoB2)
   00650 Butanoate metabolism
    HFELIS_05870 (atoB2)
  Lipid metabolism
   00071 Fatty acid degradation
    HFELIS_05870 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    HFELIS_05870 (atoB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HFELIS_05870 (atoB2)
   00310 Lysine degradation
    HFELIS_05870 (atoB2)
   00380 Tryptophan metabolism
    HFELIS_05870 (atoB2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HFELIS_05870 (atoB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HFELIS_05870 (atoB2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HFELIS_05870 (atoB2)
Enzymes [BR:hfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HFELIS_05870 (atoB2)
Exosome [BR:hfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HFELIS_05870 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
571090..572274
Genome map
AA seq 394 aa AA seqDB search
MKNLHEVYVYSAKRSPIGSFNGSLSSVPATTLGSVVGVEALKASGFDSGLVDTCIVGNVI
SAGLKQAPARQVALNAHLPNSVGCFLINEACGSGLRAVMLGASEIALGRSRVALVGGIEN
MSLAPHLLMGSRGGFKMGDAKLEDSLFKDGLRDAYQYALMGDFAEGCAKNHRLSREEQDH
FAKHSYEKALEAIKTQAFDSEIVPISIKSKKGEELVSLDEEPSKVNFEKGLKLKPAFDKE
GTITAFNASKISDGASMLVIASKELAKDTSTKPLAKILDYNSFSHDPHLFPTAPAPAIQK
LLERNHKKVSDIDLYEISEAFAVVGLLTQRELELKDTQINVHGGAIALGHPIGASGARIL
TTLVHALHRHDKHLGVACLCVGGGEAVAMLIERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttgcacgaagtctatgtttatagcgcgaaacgaagccctattgggtctttt
aatggaagtttatccagtgtgccagccacgacgctaggaagtgtggtgggtgtggaagca
ctcaaagcgagcgggtttgattctggcttggtggatacatgtattgtaggcaatgtgatt
agtgcgggtttgaagcaggctcctgctaggcaggtcgccctgaacgcccatttgcctaat
tctgtgggttgctttttgattaacgaggcgtgtgggtctggcttgagggcggtgatgttg
ggtgcgagtgaaatcgccttagggcgatctagggtggctttagtaggagggattgaaaac
atgagcctagcccctcatttgttgatggggagtagaggggggtttaaaatgggcgatgcc
aaattagaggacagcttgtttaaagatggtttgcgcgatgcttaccaatatgccttaatg
ggggattttgccgaggggtgcgctaaaaaccaccgcttgagcagagaagagcaggatcat
tttgctaaacatagctatgaaaaagctcttgaggcgatcaagactcaggcttttgattct
gagatcgtgcccattagcattaaaagcaaaaaaggggaggagctagttagcctagatgaa
gagcccagcaaagttaattttgaaaaaggtttaaaactcaagcccgcctttgataaagag
ggcacgatcaccgcttttaatgccagcaaaattagcgatggagcgagtatgttggtcatt
gctagcaaggagctagcaaaagacacctctaccaaacccttagctaaaatcctagattac
aactctttcagccacgatccccatctcttccccactgcgcctgctcctgctattcaaaag
ctcttagaaagaaaccacaaaaaagttagcgatattgatctctatgaaatcagcgaggct
tttgcagtggtgggactcttaacccaaagagaattggagcttaaagatactcaaatcaat
gtacatgggggagcgatcgcgctagggcaccccataggagctagtggcgcgcgtattctc
accacccttgtacatgccttgcacagacatgacaaacacttaggcgtggcgtgtctgtgt
gtaggcggtggcgaagcagtcgcaatgctcattgagagattatag

DBGET integrated database retrieval system