KEGG   Helicobacter felis: HFELIS_05880Help
Entry
HFELIS_05880      CDS       T01375                                 

Gene name
scoA
Definition
succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC:2.8.3.5)
Orthology
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
hfe  Helicobacter felis
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hfe00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hfe00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hfe00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572283..572984
Genome map
AA seq 233 aa AA seqDB search
MPMNKVISNIEEAIAGVQDGMTIMFGGFGLCGIPENAILALSKSGVKNITCISNNPGVDD
FGLGLLVKNKQIKKMIASYVGENATFEQQFLAGEVEVEFNPQGTLAERIRAGGAGIPGFY
TPTGVGTIIAEGKEHKEFEGRTYILETALKADFAFIKAHKADPYGNLIFNKTAMNFNPMM
AKAAQVTVVEVEEIVELGALDPNFIHVPGVFVDRIFKGSFEKRIEQLTLKKGE
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgaacaaagtaattagcaatattgaagaagccattgcgggcgtgcaagatggc
atgactatcatgtttgggggttttgggctatgtggtattccagagaacgctatcttagct
ctaagtaaaagcggggtgaaaaatatcacctgcatttctaataacccgggtgtggatgat
tttgggctgggcttgttggtgaaaaacaagcagatcaaaaagatgatcgctagctatgtg
ggcgaaaatgccacttttgagcaacaatttttagcaggagaagtagaagtagagtttaat
ccacaaggcactttagccgaacgcattagagcaggcggggcagggattccgggcttttac
acgcctacaggggtgggaactatcattgcggagggcaaggagcataaggaatttgagggg
cgcacctatattttagaaaccgcgctcaaagcagattttgcttttatcaaagcccacaag
gcagatccgtatggcaatctcattttcaataagaccgcaatgaattttaaccccatgatg
gcaaaagccgcacaagtaaccgttgtagaagtggaggaaatcgtagaattaggcgcgctc
gatcctaattttatccatgttcccggggtgtttgtggatcgcattttcaaggggagcttt
gaaaaacgcatcgaacaactcacactcaaaaagggagaatag

DBGET integrated database retrieval system