KEGG   Helicobacter felis: HFELIS_06380Help
Entry
HFELIS_06380      CDS       T01375                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hfe  Helicobacter felis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HFELIS_06380 (ruvA)
Enzymes [BR:hfe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HFELIS_06380 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(623174..623719)
Genome map
AA seq 181 aa AA seqDB search
MIVGLIGHVHSIEPTLIALNVRGVVYGVQVSLHTSSLLQEGQEVHLYTSLISKEGDQSLF
GFLELEERALFVRLIKISGVGPKIALAILSVYTPLEFATLLETQHTKALQKVPGVGSKLA
SKIMFDLEGYLPSAHQDPAYIQAVQALESLGFKSLEVQKVCADLKGLSTEEMIKEALQKL
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgattgtagggcttataggccatgtgcatagcatcgaacctacactgatagctctcaat
gtgaggggagtggtttatggcgtgcaagtaagtttacacaccagtagcctcttgcaagaa
gggcaggaagttcatttatatacctctcttattagcaaagagggcgatcagagcctcttt
ggctttttggaactggaggaacgcgcgctgtttgtgcgtttgattaaaattagtggcgtg
ggtcccaagattgccttagcaattctctctgtctacacccccttggagtttgctactcta
ctagagacacagcatactaaagccctccaaaaagttcccggagtggggagcaaattggcc
tctaagatcatgtttgatcttgagggttatctcccctcagcgcaccaagacccggcttat
attcaggcagtccaggctttagagagtttagggtttaaaagtttagaagtgcagaaagtg
tgcgcggatttaaaaggtttgagcactgaagagatgatcaaagaagcgttacagaagttg
aggtaa

DBGET integrated database retrieval system