KEGG   Helicobacter felis: HFELIS_06550Help
Entry
HFELIS_06550      CDS       T01375                                 

Definition
putative disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hfe  Helicobacter felis
Brite
Enzymes [BR:hfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HFELIS_06550
Secretion system [BR:hfe02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HFELIS_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645062..645796
Genome map
AA seq 244 aa AA seqDB search
MRKIICAMCVCVGLLSAEGVGDNVVNLIQQQVKKEVRVLEVLPLNSDKNFQVVVVEDPET
KYHIPLLANKDGSVVLGLGNVFFSKDNQDIALLNGVYHKTSLHNFKQGNGAKLNALFSGL
PKSYVIDLVSKNKKAKNIYIVSDPRCPHCQEELRHVRERLKDANVHMVVVGLLGQKSTLK
AADILTQIKQARNTETKIALLEKIYATNYEPGEVSDDKIQEVEKITKQILETGIESVPFI
YEYQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagattatttgtgccatgtgtgtttgtgtgggtttgctgagtgctgaaggggtg
ggtgataatgtggtcaatctgattcagcaacaagtaaaaaaagaggtgcgtgttttggaa
gtattacccctaaattctgataaaaattttcaagtggtggttgttgaagatccagagaca
aaatatcatattcccctattggccaataaagatgggagtgtggtgttagggctaggaaat
gtattttttagcaaggataatcaagatattgcgcttttaaatggcgtttaccacaaaacc
agtttgcataacttcaaacagggcaatggggctaaacttaatgcgttatttagcggtttg
cctaaaagctatgtcatcgatttggtctccaaaaacaagaaagctaaaaatatttacatt
gtttctgatcctagatgtccgcattgtcaggaggagttaaggcatgtccgtgaacggctt
aaggacgctaatgtgcacatggttgttgtgggtcttttgggacaaaaatctactcttaaa
gcagcagacatattgacacaaatcaaacaggcgcgcaacacagaaactaagattgcttta
ctggaaaaaatttacgctaccaattacgagcccggggaggtgtctgatgataaaattcaa
gaggtcgaaaaaattaccaagcagattttagaaacggggattgagagcgtgccttttatt
tatgaatatcaataa

DBGET integrated database retrieval system