KEGG   Helicobacter felis: HFELIS_06870Help
Entry
HFELIS_06870      CDS       T01375                                 

Definition
spermidine synthase
Orthology
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
hfe  Helicobacter felis
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Glutathione metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hfe00270]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hfe00330]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hfe00410]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hfe00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669326..670045)
Genome map
AA seq 239 aa AA seqDB search
MTHHLEIVGTDCAQVGIVRHDTQEWMFFQNYPFIQSELLAHVSACVHPNPKRALITGGFD
TQIAFELLKHEDMHVDFVQEDRAMLENLHTFLPQFQETKTHARFKLYDRILDLDLQPYDI
IISLSTLNAHQVDGLQRMLAPRGFMVSVAPSPLLEQEAFKDTLKDLQTCAQILMPFNTPY
APTPQIYLFISKHYHPLADMLLQKIDMLDGLRYYNAEIHHAAFAQPQWLKGACARLLKN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacacaccatttagaaattgtcggaacagattgtgcacaagtagggatcgtgcgtcat
gacacacaggaatggatgttttttcaaaattatccctttattcaaagtgagttattggca
catgtgagcgcgtgcgtgcaccccaaccctaaacgcgcgctcattaccggagggtttgat
acccaaatcgcttttgaattgctaaagcacgaagacatgcatgtagattttgtgcaagaa
gatcgcgcaatgttagaaaacctacacacctttttgcctcaatttcaagagactaaaacc
catgcgcgcttcaagctttatgataggattttagacctagatttacagccctatgacatt
atcatctctttaagcaccctcaacgcccaccaagtggacggcttgcaacgcatgctagcc
cctaggggtttcatggtctcagtcgctcctagtcctcttctcgagcaagaagcctttaag
gacacgctcaaagatttgcaaacctgtgcgcaaattctgatgccttttaacaccccctac
gctcccacgcctcagatttatctttttatttctaaacattaccaccccctagcggatatg
ttgctccaaaaaatcgacatgctcgatggcttgcgttactataatgctgaaatccaccat
gctgcctttgcccagcctcagtggctcaagggcgcgtgcgcgcgtttgcttaaaaattga

DBGET integrated database retrieval system