KEGG   Helicobacter felis: HFELIS_07790Help
Entry
HFELIS_07790      CDS       T01375                                 

Definition
pyruvate ferredoxin oxidoreductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hfe  Helicobacter felis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hfe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hfe00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hfe00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hfe00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hfe00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hfe00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hfe00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
763527..764087
Genome map
AA seq 186 aa AA seqDB search
MLEIRWHARAGQGAVTGAKGLADVLTTTGKEVQGFAVYGSAKRGAAMTAYNRIDSEPILN
HEKFMNPDYVLVIDPGLTFITDITENEKPDTTYIITTHLSKDELFEKKPNLASKKVYTLN
CIKIAMDTIKRPIPNTPMLGALMKVSGMLELDFFKNTFKEVLGKKMPQALIDANMMAIDQ
AYAQVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaattagatggcatgctagggccgggcagggcgcggttaccggcgcaaaaggc
ttggccgatgtgctcaccactaccggcaaagaggtgcagggttttgcagtctatggttcg
gctaaaagaggggcagcgatgaccgcctataaccgcatcgattctgagcctattttaaat
cacgaaaaatttatgaatcccgattatgttttggtaatcgatccgggtttgactttcatt
acagacattacagaaaatgaaaaaccggacaccacttatatcatcaccactcacctaagc
aaggatgaattgtttgagaaaaagcctaacttggccagcaaaaaggtttataccttgaat
tgtatcaaaattgccatggacaccatcaaacgccccattcctaacacgcctatgttgggg
gctttgatgaaggtatctggtatgttggagttggacttttttaaaaacacctttaaagag
gtgttgggtaaaaaaatgcctcaggctttgattgatgccaacatgatggctatcgatcag
gcttacgcccaagtgcaataa

DBGET integrated database retrieval system