KEGG   Helicobacter felis: HFELIS_07800Help
Entry
HFELIS_07800      CDS       T01375                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hfe  Helicobacter felis
Pathway
hfe00010  Glycolysis / Gluconeogenesis
hfe00020  Citrate cycle (TCA cycle)
hfe00620  Pyruvate metabolism
hfe00640  Propanoate metabolism
hfe00650  Butanoate metabolism
hfe00680  Methane metabolism
hfe01100  Metabolic pathways
hfe01120  Microbial metabolism in diverse environments
hfe01130  Biosynthesis of antibiotics
hfe01200  Carbon metabolism
Module
hfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFELIS_07800
   00020 Citrate cycle (TCA cycle)
    HFELIS_07800
   00620 Pyruvate metabolism
    HFELIS_07800
   00640 Propanoate metabolism
    HFELIS_07800
   00650 Butanoate metabolism
    HFELIS_07800
  Energy metabolism
   00680 Methane metabolism
    HFELIS_07800
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HFELIS_07800
Enzymes [BR:hfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HFELIS_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_10 Fer4_2 Fer4_6 Fer4_17 Fer4_9 Fer4_7 Fer4_15 Fer4_16 Fer4_8 Fer4_13 Fer4_4 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CBY82864
UniProt: E7ABI5
Position
764097..764525
Genome map
AA seq 142 aa AA seqDB search
MKNWQEFEIGGVLFPFEKQGQDELHKHNDERTYTQESSFTDSVSHWRVEKPVHNKEVCIN
CFNCWVYCPDASILSREGKMSGVDYDHCKGCGVCVDVCPTNPKSLLMFDNLEPLEEALTK
WPQKAEGLKKKSYRTEGGYNGF
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattggcaagaatttgaaatagggggcgtgctcttcccctttgaaaaacagggt
caagacgagcttcataagcacaatgatgagcgcacctacacccaagagagttcttttact
gacagcgtttcccattggcgtgtagaaaaacccgtgcacaataaagaagtgtgtatcaac
tgctttaactgctgggtgtattgtccggatgcttccattctctctagggagggcaagatg
agcggagtggattatgatcactgcaaaggttgcggggtgtgcgtggatgtctgccccact
aatcctaaatctctgctcatgtttgacaatttggaacccctagaagaggcgctcaccaag
tggcctcaaaaagccgaagggttgaaaaagaaaagttaccgcacagaagggggttacaat
gggttctag

DBGET integrated database retrieval system