KEGG   Helicobacter felis: HFELIS_07800Help
Entry
HFELIS_07800      CDS       T01375                                 

Definition
pyruvate ferredoxin oxidoreductase, subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hfe  Helicobacter felis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFELIS_07800
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFELIS_07800
   00020 Citrate cycle (TCA cycle)
    HFELIS_07800
   00620 Pyruvate metabolism
    HFELIS_07800
   00640 Propanoate metabolism
    HFELIS_07800
   00650 Butanoate metabolism
    HFELIS_07800
  Energy metabolism
   00680 Methane metabolism
    HFELIS_07800
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HFELIS_07800
Enzymes [BR:hfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HFELIS_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
764097..764525
Genome map
AA seq 142 aa AA seqDB search
MKNWQEFEIGGVLFPFEKQGQDELHKHNDERTYTQESSFTDSVSHWRVEKPVHNKEVCIN
CFNCWVYCPDASILSREGKMSGVDYDHCKGCGVCVDVCPTNPKSLLMFDNLEPLEEALTK
WPQKAEGLKKKSYRTEGGYNGF
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattggcaagaatttgaaatagggggcgtgctcttcccctttgaaaaacagggt
caagacgagcttcataagcacaatgatgagcgcacctacacccaagagagttcttttact
gacagcgtttcccattggcgtgtagaaaaacccgtgcacaataaagaagtgtgtatcaac
tgctttaactgctgggtgtattgtccggatgcttccattctctctagggagggcaagatg
agcggagtggattatgatcactgcaaaggttgcggggtgtgcgtggatgtctgccccact
aatcctaaatctctgctcatgtttgacaatttggaacccctagaagaggcgctcaccaag
tggcctcaaaaagccgaagggttgaaaaagaaaagttaccgcacagaagggggttacaat
gggttctag

DBGET integrated database retrieval system