KEGG   Helicobacter felis: HFELIS_08330Help
Entry
HFELIS_08330      CDS       T01375                                 

Definition
putative phospho-sugar mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hfe  Helicobacter felis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFELIS_08330
   00030 Pentose phosphate pathway
    HFELIS_08330
   00051 Fructose and mannose metabolism
    HFELIS_08330
   00052 Galactose metabolism
    HFELIS_08330
   00500 Starch and sucrose metabolism
    HFELIS_08330
   00520 Amino sugar and nucleotide sugar metabolism
    HFELIS_08330
  Nucleotide metabolism
   00230 Purine metabolism
    HFELIS_08330
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HFELIS_08330
Enzymes [BR:hfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HFELIS_08330
    5.4.2.8  phosphomannomutase
     HFELIS_08330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(812186..813580)
Genome map
AA seq 464 aa AA seqDB search
MPLDSSIFREYDIRGIFGQNLNESCVRQIGLELGALMAKSCAKVALGYDARTHSPILFEW
LKSGLENFVEVYDLGLIPTPVAYFATFNSIEGVQIPHSIMITGSHNPPEYNGFKITLNQK
PFYGQAIQELKVKMLDNPTPYKSTPTTTHKLKAKQAYHSYLINAFSHLKDFSYKIALDFG
NGVGALGLEPVLRALNISFDSLYPNPDGTFPNHHPDPSEAKNLQDLQKHMQAHNIPIGIA
FDGDADRVALLTQNHIYAGDELAILFAQSLAREGIKPLVIGEVKCSQVMYDTINQLGQAL
MYKTGHSNLKVKLKEINAHFAAEMSGHLFFNDRYFGYDDALYAALRILELFLHSTPTELE
GVINALPYSYKTPEEKIHVLEEEKFALIEQLKDVLKGQLPSNFPPIVEVIDIDGVRVVFE
HGFALVRASNTTPTLVTRFEGKDEACAQEYKEALLSLLQHRGTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccattagattcgagcatttttagggaatacgacattagggggatttttgggcagaat
ttaaacgaatcttgcgtgcgccaaatcgggctagaattgggcgctctcatggctaagagt
tgtgctaaagtggcgctaggctatgacgcgcgcacccactcacccattttatttgagtgg
cttaaaagcgggcttgaaaactttgtagaagtctatgatttagggctcatccccacccct
gtcgcctattttgctacctttaactccattgagggcgtgcaaatcccccactctattatg
atcaccggctcgcacaacccccctgaatataatggttttaaaatcactctaaatcaaaaa
cccttctatggtcaagccatccaagagttaaaagttaaaatgctggataaccccacaccc
tataagtctacacccactaccacccacaagctcaaggcaaagcaagcctatcatagctac
ctcattaacgccttttctcatcttaaagacttctcctataaaatcgccctagattttggt
aatggcgtgggggctttggggttagaacccgtgctaagggcgttaaatatcagttttgat
agtctgtatcctaatccggatggcacttttcctaaccaccaccccgatcctagtgaagct
aaaaatctacaagatttacaaaaacacatgcaagcgcacaacatccccatagggatcgcc
tttgatggggatgcggatcgcgttgccttgctcacacaaaatcacatttacgcaggcgat
gagttagccattctttttgcccaaagcctagcaagagaggggattaaaccccttgtgatt
ggcgaggtcaaatgttcacaggtgatgtatgacaccattaaccagctaggtcaagcgctg
atgtataaaacagggcatagcaatttaaaagtcaagctcaaagaaattaacgcccatttt
gctgctgagatgagcgggcatttattctttaacgatcgctactttggctatgacgatgct
ctctatgctgctctgcgcattttagagctatttttacactccacgcctacagagttagag
ggtgtcattaacgccctgccctattcgtataaaacccctgaagaaaaaatccatgtctta
gaagaggaaaaatttgccctcattgaacaacttaaagatgtattaaaaggacaacttcct
tcaaattttccgcccattgtggaggtgattgacatcgatggggtgcgtgtggtttttgaa
catggctttgctttggtgcgcgctagcaacactacgcccacgctagtaacccgctttgag
ggcaaagacgaagcctgcgcccaagaatataaggaggcgctcttaagtctcttgcaacat
agaggcacgcattag

DBGET integrated database retrieval system