KEGG   Helicobacter felis: HFELIS_09980Help
Entry
HFELIS_09980      CDS       T01375                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hfe  Helicobacter felis
Pathway
hfe00260  Glycine, serine and threonine metabolism
hfe00750  Vitamin B6 metabolism
hfe01100  Metabolic pathways
hfe01110  Biosynthesis of secondary metabolites
hfe01120  Microbial metabolism in diverse environments
hfe01230  Biosynthesis of amino acids
Module
hfe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFELIS_09980 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HFELIS_09980 (thrC)
Enzymes [BR:hfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HFELIS_09980 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CBY83082
UniProt: E7ACW4
Position
complement(989270..990712)
Genome map
AA seq 480 aa AA seqDB search
MAHMIDTRDAHSLGSFTDSLLNPAQSSGLCAPQSLPQIDFSGYLNLNYTQLARTLFQVLE
LDLDPDLLEVALDRYHAFEALAPLRTLKPTLHVLELFHGPTLAFKDMALQPFGVLLSGLA
QARDEKYLIMVATSGDTGPATLASFANLPNTYVFCLYPAEGTSLIQALQMQSMDAPNLKV
VGLEGNFDDAQSALKALLADESFQAHLAQKDLHLSVANSINFGRIIFQMVYHIWGYLELV
RQRTITYSDPIKILIPSGNFGNALGAFYAKAMGLPVEKISVVSNANDVLTEFFNTGVYDL
RSRSLLKTPSPAMDILKSSNVERLLFALFGSARTKECMQQLQDQKYYALTSSELQSLRAH
FEAFSCDDAHCLDTIARIYGDHHYLADPHTATALYAYERLKSRLPCVVVSTASWSKFAHT
TALALGKQAKDDQEALQVLAKEGITPPASVQELLSKPLVHQDRVGVSDLQHYIKTWLKNF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcacacatgatagatacacgagatgcccattctctaggtagctttacagattctcta
ctcaatccggctcaaagtagcgggctttgtgcccctcaaagtctgccccaaatagacttt
tcaggctatctaaacttgaattacacccaactagcccgcacactctttcaggtcctagaa
cttgatcttgatcccgatctcttagaagtagctctcgatcgttatcatgcctttgaggct
cttgcccctttgcgcacgcttaaacccaccctgcatgtcttagaactttttcatggcccc
actctagcttttaaagacatggcactccagccctttggggtgttgctctcaggattggct
caagcgcgcgatgaaaagtatctcattatggtggccactagcggggatacaggtccagcg
actttggctagctttgctaatctgcctaatacctacgtcttttgtttgtatccagctgag
ggtacaagcctaatccaagctttgcaaatgcagagcatggacgcacccaatctcaaggta
gtcggattggagggaaattttgatgacgctcaaagcgcgcttaaagcccttttagccgat
gaatcttttcaagcacatttagctcaaaaagacttgcatttgagcgtagccaattcgatc
aattttgggcgtatcatcttccagatggtctatcacatttggggatatttggagttggtg
cgccaaaggacgattacctatagcgatcctattaaaattctcattcctagcgggaatttt
ggcaacgctctaggcgcgttctatgctaaagcgatgggcttacctgtggaaaaaatcagc
gtggtgtctaatgctaatgatgtgctcaccgagttttttaatacaggggtttatgatctg
cgctcccgtagtttgctcaaaaccccctccccagccatggacattctcaaaagttccaat
gtggaacgcctgctgtttgctctctttggctctgcacgcactaaggagtgcatgcagcaa
ctccaagatcaaaaatattacgccctcacttctagcgagctacagagcttgcgcgcgcat
tttgaggcgtttagctgtgatgacgcgcattgtttagacaccatcgcacgcatttatggc
gatcaccactacctagcagacccccacaccgctaccgcgctttatgcttacgaacgcctt
aagagtcgcctaccctgtgtagtggtttccactgcctcgtggagcaaatttgcccacacc
accgccctagctctaggcaaacaagccaaagacgatcaggaagctttacaagttttagcc
aaagaggggatcacccccccagccagcgtgcaagagctcttaagtaagccccttgtgcat
caggatcgcgtgggtgtgagcgacctacaacattacattaaaacatggttaaaaaatttc
tag

DBGET integrated database retrieval system