KEGG   Helicobacter felis: HFELIS_09980Help
Entry
HFELIS_09980      CDS       T01375                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hfe  Helicobacter felis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFELIS_09980 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFELIS_09980 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HFELIS_09980 (thrC)
Enzymes [BR:hfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HFELIS_09980 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(989270..990712)
Genome map
AA seq 480 aa AA seqDB search
MAHMIDTRDAHSLGSFTDSLLNPAQSSGLCAPQSLPQIDFSGYLNLNYTQLARTLFQVLE
LDLDPDLLEVALDRYHAFEALAPLRTLKPTLHVLELFHGPTLAFKDMALQPFGVLLSGLA
QARDEKYLIMVATSGDTGPATLASFANLPNTYVFCLYPAEGTSLIQALQMQSMDAPNLKV
VGLEGNFDDAQSALKALLADESFQAHLAQKDLHLSVANSINFGRIIFQMVYHIWGYLELV
RQRTITYSDPIKILIPSGNFGNALGAFYAKAMGLPVEKISVVSNANDVLTEFFNTGVYDL
RSRSLLKTPSPAMDILKSSNVERLLFALFGSARTKECMQQLQDQKYYALTSSELQSLRAH
FEAFSCDDAHCLDTIARIYGDHHYLADPHTATALYAYERLKSRLPCVVVSTASWSKFAHT
TALALGKQAKDDQEALQVLAKEGITPPASVQELLSKPLVHQDRVGVSDLQHYIKTWLKNF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcacacatgatagatacacgagatgcccattctctaggtagctttacagattctcta
ctcaatccggctcaaagtagcgggctttgtgcccctcaaagtctgccccaaatagacttt
tcaggctatctaaacttgaattacacccaactagcccgcacactctttcaggtcctagaa
cttgatcttgatcccgatctcttagaagtagctctcgatcgttatcatgcctttgaggct
cttgcccctttgcgcacgcttaaacccaccctgcatgtcttagaactttttcatggcccc
actctagcttttaaagacatggcactccagccctttggggtgttgctctcaggattggct
caagcgcgcgatgaaaagtatctcattatggtggccactagcggggatacaggtccagcg
actttggctagctttgctaatctgcctaatacctacgtcttttgtttgtatccagctgag
ggtacaagcctaatccaagctttgcaaatgcagagcatggacgcacccaatctcaaggta
gtcggattggagggaaattttgatgacgctcaaagcgcgcttaaagcccttttagccgat
gaatcttttcaagcacatttagctcaaaaagacttgcatttgagcgtagccaattcgatc
aattttgggcgtatcatcttccagatggtctatcacatttggggatatttggagttggtg
cgccaaaggacgattacctatagcgatcctattaaaattctcattcctagcgggaatttt
ggcaacgctctaggcgcgttctatgctaaagcgatgggcttacctgtggaaaaaatcagc
gtggtgtctaatgctaatgatgtgctcaccgagttttttaatacaggggtttatgatctg
cgctcccgtagtttgctcaaaaccccctccccagccatggacattctcaaaagttccaat
gtggaacgcctgctgtttgctctctttggctctgcacgcactaaggagtgcatgcagcaa
ctccaagatcaaaaatattacgccctcacttctagcgagctacagagcttgcgcgcgcat
tttgaggcgtttagctgtgatgacgcgcattgtttagacaccatcgcacgcatttatggc
gatcaccactacctagcagacccccacaccgctaccgcgctttatgcttacgaacgcctt
aagagtcgcctaccctgtgtagtggtttccactgcctcgtggagcaaatttgcccacacc
accgccctagctctaggcaaacaagccaaagacgatcaggaagctttacaagttttagcc
aaagaggggatcacccccccagccagcgtgcaagagctcttaagtaagccccttgtgcat
caggatcgcgtgggtgtgagcgacctacaacattacattaaaacatggttaaaaaatttc
tag

DBGET integrated database retrieval system