KEGG   Helicobacter felis: HFELIS_10570Help
Entry
HFELIS_10570      CDS       T01375                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hfe  Helicobacter felis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hfe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hfe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047543..1048688
Genome map
AA seq 381 aa AA seqDB search
MNVVQLTQKLISYQTITPKEEGIFDCVGAVLRDFEVLRADQNGVSNVFFYKRFGDPAQTP
LHFCFAGHIDVVPVGAGWKHDPFEGVVEDDILYGRGAQDMKGGIGAFLSALHAVCAELAD
NPPPLILSVLLTSDEEGAARFGTKYMLEVLQEKNLLPHYALVAEPTSAKLLGDSVKIGRR
GSIGGKIIVQGIPGHVAYPKTSLNPINLIADKLNLIADAHLDKANAHFEPSRLVITSLKS
ISDAENVTPQTLEICFNVRHSPQVTLEDVAHFLDAILEKVPCSITLQQNSLPFLSSQNCA
LVGHIQEAITAVLERTPSLNTYGGTSDARFFAACGVEVVEFGLLNSHIHSIDECVSIEDL
NNLCAVFVELLHLIIKEAHGK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcgtgcaactgactcaaaagctcatcagttaccaaaccatcactccaaaagag
gaagggatttttgattgtgtcggggcggttttgagagactttgaagtgttgcgcgccgat
caaaatggcgtgagcaatgtctttttttacaaacgctttggtgatcctgcccaaactccc
ctgcatttttgctttgccgggcatattgatgtcgtgcctgtaggggcgggatggaagcat
gatccctttgagggcgtggtggaggatgatattttgtatgggcgcggagcacaggacatg
aaaggaggaataggggcttttttaagcgcattgcacgccgtgtgtgctgagcttgcagac
aatcctccccccctcattctctctgttttgctcactagcgatgaagagggcgctgcgcgt
tttgggactaaatacatgctcgaggtcttgcaagaaaaaaatctcttgccccattatgcc
ttagtcgctgaacctaccagtgccaagttgttaggcgatagcgttaaaatcggaaggcgg
gggtctattggagggaaaatcatagtgcagggcattcccgggcatgttgcctaccctaaa
acctccctcaatcctatcaatcttatcgctgataagctcaatctcatcgccgatgcgcac
ttggataaagccaatgcccattttgagccctctaggttggtcattacctcgctaaaaagc
atttcagacgcagagaatgttacccctcaaaccctagaaatctgttttaatgtgcgccat
tccccccaagttaccctagaggatgtggcccatttcttagacgctattttagaaaaagtc
ccttgcagtataactttacagcaaaattctctgccctttttgagttctcaaaactgcgcc
ttagttgggcacattcaagaggctatcaccgcagtgcttgagcgcacgccttcgctcaac
acttatggaggcactagcgatgcgcgtttttttgctgcctgcggagtggaggtggtagaa
tttggtctgctcaatagccatatccattccattgatgaatgcgtatctattgaagatttg
aataatctttgtgcggtctttgtagaattattacatcttattattaaggaagcgcatggc
aaataa

DBGET integrated database retrieval system