KEGG   Helicobacter felis: HFELIS_10570Help
Entry
HFELIS_10570      CDS       T01375                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hfe  Helicobacter felis
Pathway
hfe00300  Lysine biosynthesis
hfe01100  Metabolic pathways
hfe01120  Microbial metabolism in diverse environments
hfe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HFELIS_10570
Enzymes [BR:hfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HFELIS_10570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CBY83141
UniProt: E7AD23
Position
1047543..1048688
Genome map
AA seq 381 aa AA seqDB search
MNVVQLTQKLISYQTITPKEEGIFDCVGAVLRDFEVLRADQNGVSNVFFYKRFGDPAQTP
LHFCFAGHIDVVPVGAGWKHDPFEGVVEDDILYGRGAQDMKGGIGAFLSALHAVCAELAD
NPPPLILSVLLTSDEEGAARFGTKYMLEVLQEKNLLPHYALVAEPTSAKLLGDSVKIGRR
GSIGGKIIVQGIPGHVAYPKTSLNPINLIADKLNLIADAHLDKANAHFEPSRLVITSLKS
ISDAENVTPQTLEICFNVRHSPQVTLEDVAHFLDAILEKVPCSITLQQNSLPFLSSQNCA
LVGHIQEAITAVLERTPSLNTYGGTSDARFFAACGVEVVEFGLLNSHIHSIDECVSIEDL
NNLCAVFVELLHLIIKEAHGK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcgtgcaactgactcaaaagctcatcagttaccaaaccatcactccaaaagag
gaagggatttttgattgtgtcggggcggttttgagagactttgaagtgttgcgcgccgat
caaaatggcgtgagcaatgtctttttttacaaacgctttggtgatcctgcccaaactccc
ctgcatttttgctttgccgggcatattgatgtcgtgcctgtaggggcgggatggaagcat
gatccctttgagggcgtggtggaggatgatattttgtatgggcgcggagcacaggacatg
aaaggaggaataggggcttttttaagcgcattgcacgccgtgtgtgctgagcttgcagac
aatcctccccccctcattctctctgttttgctcactagcgatgaagagggcgctgcgcgt
tttgggactaaatacatgctcgaggtcttgcaagaaaaaaatctcttgccccattatgcc
ttagtcgctgaacctaccagtgccaagttgttaggcgatagcgttaaaatcggaaggcgg
gggtctattggagggaaaatcatagtgcagggcattcccgggcatgttgcctaccctaaa
acctccctcaatcctatcaatcttatcgctgataagctcaatctcatcgccgatgcgcac
ttggataaagccaatgcccattttgagccctctaggttggtcattacctcgctaaaaagc
atttcagacgcagagaatgttacccctcaaaccctagaaatctgttttaatgtgcgccat
tccccccaagttaccctagaggatgtggcccatttcttagacgctattttagaaaaagtc
ccttgcagtataactttacagcaaaattctctgccctttttgagttctcaaaactgcgcc
ttagttgggcacattcaagaggctatcaccgcagtgcttgagcgcacgccttcgctcaac
acttatggaggcactagcgatgcgcgtttttttgctgcctgcggagtggaggtggtagaa
tttggtctgctcaatagccatatccattccattgatgaatgcgtatctattgaagatttg
aataatctttgtgcggtctttgtagaattattacatcttattattaaggaagcgcatggc
aaataa

DBGET integrated database retrieval system