KEGG   Helicobacter felis: HFELIS_11500Help
Entry
HFELIS_11500      CDS       T01375                                 

Definition
(GenBank) Arginase (EC 3.5.3.1)
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hfe  Helicobacter felis
Pathway
hfe00220  Arginine biosynthesis
hfe00330  Arginine and proline metabolism
hfe01100  Metabolic pathways
hfe01110  Biosynthesis of secondary metabolites
hfe01130  Biosynthesis of antibiotics
hfe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HFELIS_11500
   00330 Arginine and proline metabolism
    HFELIS_11500
Enzymes [BR:hfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HFELIS_11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CBY83234
UniProt: E7A8V3
Position
complement(1139306..1140280)
Genome map
AA seq 324 aa AA seqDB search
MVLVNLVAELGAAKHGSRVGVEKLKSRLIECYPQITEHMALIRQRQCVLERFFRYAKNFE
DYYFFCKDSLIPTMHAIFKRGSFPLILSAEHSGAFGIAQALRSVHPDKKIGILYLDAHAD
IHTAYDSDSGNLHGMPLGMVLNRIHSGQNVLNDQEKHYWESLCALGLEDGALDFDPKHLI
YFGVRSTEASEREMIKKYHIPLFSIEAIRADMPGVVQQTQALLEEVDLVYLSLDVDVLDG
KIFSSTGVRENNGLQPQELQALLDSLLRAFGERLACVEITEYNPELWNGEEEDEKVVWGL
LTRVVEHALNRDSNLVRREDDRFA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggttttagtcaatcttgttgcagaattaggtgcagccaaacacgggagcagagtaggc
gtggagaaactcaaaagccgtttgatagagtgttatccacaaatcacagaacacatggcg
cttatccgtcagaggcagtgcgtgctggagaggttttttagatatgcgaagaatttcgag
gattactactttttttgtaaagatagtttgatccctacaatgcacgccatctttaaaagg
ggaagtttccctctcattttaagcgcagaacactctggagcctttgggattgcacaagcc
ctgcgatctgtgcatcctgataagaagataggtatcctctatttggacgcgcatgcagac
atccacaccgcttatgatagtgattcggggaatctgcatggcatgcctttaggaatggtg
ctcaatagaatccatagcggtcaaaatgtgctaaacgatcaagaaaaacactactgggaa
agtctttgtgcgttgggcttggaggatggcgcactagattttgatcccaaacacttaatt
tattttggtgtccgcagcactgaagcgagcgagagggagatgatcaaaaagtatcatatc
cccctttttagtatagaggcgattcgtgcggatatgcccggtgtggtgcagcagactcaa
gcccttttggaggaagtggatttggtgtatttgagcctagatgtcgatgtgttggatggt
aaaattttcagctctacgggcgtgcgcgaaaataatggcctgcaaccccaagagctccaa
gcgttgttagatagtctcttaagggcgtttggtgagcgtttggcgtgtgtagaaatcacc
gaatacaatccggagttatggaatggtgaagaggaggatgaaaaagttgtgtgggggctt
ttgacacgtgttgtagaacacgcgctaaatagagattcaaatctagtaaggagagaagat
gatcgctttgcttaa

DBGET integrated database retrieval system