KEGG   Helicobacter felis: HFELIS_11500Help
Entry
HFELIS_11500      CDS       T01375                                 

Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
hfe  Helicobacter felis
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFELIS_11500
  Amino acid metabolism
   00220 Arginine biosynthesis
    HFELIS_11500
   00330 Arginine and proline metabolism
    HFELIS_11500
Enzymes [BR:hfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HFELIS_11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1139306..1140280)
Genome map
AA seq 324 aa AA seqDB search
MVLVNLVAELGAAKHGSRVGVEKLKSRLIECYPQITEHMALIRQRQCVLERFFRYAKNFE
DYYFFCKDSLIPTMHAIFKRGSFPLILSAEHSGAFGIAQALRSVHPDKKIGILYLDAHAD
IHTAYDSDSGNLHGMPLGMVLNRIHSGQNVLNDQEKHYWESLCALGLEDGALDFDPKHLI
YFGVRSTEASEREMIKKYHIPLFSIEAIRADMPGVVQQTQALLEEVDLVYLSLDVDVLDG
KIFSSTGVRENNGLQPQELQALLDSLLRAFGERLACVEITEYNPELWNGEEEDEKVVWGL
LTRVVEHALNRDSNLVRREDDRFA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggttttagtcaatcttgttgcagaattaggtgcagccaaacacgggagcagagtaggc
gtggagaaactcaaaagccgtttgatagagtgttatccacaaatcacagaacacatggcg
cttatccgtcagaggcagtgcgtgctggagaggttttttagatatgcgaagaatttcgag
gattactactttttttgtaaagatagtttgatccctacaatgcacgccatctttaaaagg
ggaagtttccctctcattttaagcgcagaacactctggagcctttgggattgcacaagcc
ctgcgatctgtgcatcctgataagaagataggtatcctctatttggacgcgcatgcagac
atccacaccgcttatgatagtgattcggggaatctgcatggcatgcctttaggaatggtg
ctcaatagaatccatagcggtcaaaatgtgctaaacgatcaagaaaaacactactgggaa
agtctttgtgcgttgggcttggaggatggcgcactagattttgatcccaaacacttaatt
tattttggtgtccgcagcactgaagcgagcgagagggagatgatcaaaaagtatcatatc
cccctttttagtatagaggcgattcgtgcggatatgcccggtgtggtgcagcagactcaa
gcccttttggaggaagtggatttggtgtatttgagcctagatgtcgatgtgttggatggt
aaaattttcagctctacgggcgtgcgcgaaaataatggcctgcaaccccaagagctccaa
gcgttgttagatagtctcttaagggcgtttggtgagcgtttggcgtgtgtagaaatcacc
gaatacaatccggagttatggaatggtgaagaggaggatgaaaaagttgtgtgggggctt
ttgacacgtgttgtagaacacgcgctaaatagagattcaaatctagtaaggagagaagat
gatcgctttgcttaa

DBGET integrated database retrieval system