KEGG   Helicobacter felis: HFELIS_11500Help
Entry
HFELIS_11500      CDS       T01375                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hfe  Helicobacter felis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hfe01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hfe00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1139306..1140280)
Genome map
AA seq 324 aa AA seqDB search
MVLVNLVAELGAAKHGSRVGVEKLKSRLIECYPQITEHMALIRQRQCVLERFFRYAKNFE
DYYFFCKDSLIPTMHAIFKRGSFPLILSAEHSGAFGIAQALRSVHPDKKIGILYLDAHAD
IHTAYDSDSGNLHGMPLGMVLNRIHSGQNVLNDQEKHYWESLCALGLEDGALDFDPKHLI
YFGVRSTEASEREMIKKYHIPLFSIEAIRADMPGVVQQTQALLEEVDLVYLSLDVDVLDG
KIFSSTGVRENNGLQPQELQALLDSLLRAFGERLACVEITEYNPELWNGEEEDEKVVWGL
LTRVVEHALNRDSNLVRREDDRFA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggttttagtcaatcttgttgcagaattaggtgcagccaaacacgggagcagagtaggc
gtggagaaactcaaaagccgtttgatagagtgttatccacaaatcacagaacacatggcg
cttatccgtcagaggcagtgcgtgctggagaggttttttagatatgcgaagaatttcgag
gattactactttttttgtaaagatagtttgatccctacaatgcacgccatctttaaaagg
ggaagtttccctctcattttaagcgcagaacactctggagcctttgggattgcacaagcc
ctgcgatctgtgcatcctgataagaagataggtatcctctatttggacgcgcatgcagac
atccacaccgcttatgatagtgattcggggaatctgcatggcatgcctttaggaatggtg
ctcaatagaatccatagcggtcaaaatgtgctaaacgatcaagaaaaacactactgggaa
agtctttgtgcgttgggcttggaggatggcgcactagattttgatcccaaacacttaatt
tattttggtgtccgcagcactgaagcgagcgagagggagatgatcaaaaagtatcatatc
cccctttttagtatagaggcgattcgtgcggatatgcccggtgtggtgcagcagactcaa
gcccttttggaggaagtggatttggtgtatttgagcctagatgtcgatgtgttggatggt
aaaattttcagctctacgggcgtgcgcgaaaataatggcctgcaaccccaagagctccaa
gcgttgttagatagtctcttaagggcgtttggtgagcgtttggcgtgtgtagaaatcacc
gaatacaatccggagttatggaatggtgaagaggaggatgaaaaagttgtgtgggggctt
ttgacacgtgttgtagaacacgcgctaaatagagattcaaatctagtaaggagagaagat
gatcgctttgcttaa

DBGET integrated database retrieval system