KEGG   Helicobacter felis: HFELIS_11630Help
Entry
HFELIS_11630      CDS       T01375                                 

Gene name
hemD
Definition
putative Uroporphyrinogen-III synthase, HemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hfe  Helicobacter felis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HFELIS_11630 (hemD)
Enzymes [BR:hfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HFELIS_11630 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1148671..1149363)
Genome map
AA seq 230 aa AA seqDB search
MSSIVVVSPTPYKGDLATSLVCNEIVYLPLQCVDFTLSSSLSAPIDLKTLQALVFTSKHA
PLALEHSLGSSSALAFLKTLPVFALAIKSAQVAQSLGFHVIFTGQSAHAFSFAKEIQPYL
PSNALFVRAKITASNSLDHLPSLIVYENRPLVLPQECKPKPYSILIFTAPSAYHAFVANF
SWEKSYQAIAIGASTFKAFDSAICAHQSPKPSLEACIALAKTLASCTKIP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttccattgtggtggtcagtcctaccccctataagggggatttggccacctctttg
gtgtgcaatgagattgtctatttacctttgcaatgtgtagattttacccttagttcctct
ctgagcgcgcccatagacctaaaaactctccaagcccttgttttcacttctaagcacgcc
cctctagccttagaacattctctaggcagtagttctgccttagcctttttaaaaacccta
cccgtctttgcattagcgatcaaaagcgcgcaagtggcgcaatccttaggttttcatgtg
atttttacagggcagagtgctcatgccttcagttttgctaaggaaatccagccctattta
ccctccaacgcgctctttgtgcgggctaagatcactgcctcaaatagcctagatcatttg
ccctctttgatcgtctatgagaatcgacctcttgtattgcctcaagagtgtaagccaaaa
ccctactctattcttattttcaccgcacctagtgcctaccatgcctttgtggctaatttt
tcgtgggagaagagttatcaggcgatcgccattggtgcgagcacttttaaagcttttgat
tctgctatctgtgcccatcaaagccctaaacctagcctagaagcttgtattgcattagcc
aaaaccctcgcatcttgtactaagataccctaa

DBGET integrated database retrieval system