KEGG   Helicobacter felis: HFELIS_12200Help
Entry
HFELIS_12200      CDS       T01375                                 

Gene name
ispE
Definition
putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hfe  Helicobacter felis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HFELIS_12200 (ispE)
Enzymes [BR:hfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HFELIS_12200 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1197287..1198072)
Genome map
AA seq 261 aa AA seqDB search
MKAFEFEVFPKINIFLKLIGREGGYHTLISRLALVKDSFKDWIAVKPSSCFSLKGDFNCS
LSQNTIYKMLQILKNYLKPSLASCLEQLSIEVQKNIPVGAGLGGGSADAGVLLKELNTHL
ELGLSLEQCYDIGAQVGSDVNFFISGFSSANVYHFGEVVESFEENPISIEICTPLNTACE
TPKVYQAFDSLPPPTKTGESWSATRSADLLKNFTQSTLNDLYRPATTLYPTLREFEAGLD
PQFKWFFSGSGSSFFRLKEEA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcctttgaatttgaggtttttcccaagatcaatatttttttaaagcttattggt
cgtgagggtggttatcacactcttatctctaggcttgcattagtcaaagatagctttaaa
gactggatagccgtaaaaccctcttcttgcttttcacttaagggcgattttaactgctcc
ttgtctcaaaatacgatctacaaaatgctacaaatcctcaaaaattatctaaaaccctcc
ctagcgtcttgcttagaacaactcagtattgaggtgcaaaaaaatatccctgtaggtgca
gggcttgggggggggagtgctgatgctggagtgcttttaaaagaacttaatacgcatttg
gagttaggtttgagtttagagcagtgttatgatattggcgcacaagtagggagcgatgtg
aatttttttatctcgggtttttcaagcgcaaatgtctaccactttggagaagtggtcgag
tcttttgaggaaaaccctatctccatagaaatttgcacacctttaaataccgcttgtgaa
acaccaaaagtgtatcaggcttttgattctctccctccacctacaaaaacaggggaatcg
tggtctgccacgcgcagtgccgatctcttgaaaaattttacacaatccacactcaacgat
ctttaccgccctgctacaactctctatcccactcttagagagtttgaagcgggtttagac
cctcagtttaaatggttttttagcggtagtgggagcagtttttttagactcaaggaagag
gcgtga

DBGET integrated database retrieval system