KEGG   Helicobacter felis: HFELIS_13840Help
Entry
HFELIS_13840      CDS       T01375                                 

Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hfe  Helicobacter felis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HFELIS_13840
Enzymes [BR:hfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HFELIS_13840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1360607..1361152
Genome map
AA seq 181 aa AA seqDB search
MECASKTLWWCKILKPQCYEDRGKLVYTSCFPGWCGRSHAFKNAVTLGIGSNVGDSKKVF
RALWGWLARHRLVSRLCSSPLYINPAFGYTNQRDFTNATLSFQTPLSVGQLFSMLFYLER
RWGRERKRPFKNAPRTLDIDLLFFNRMVYRQDYLTLPHPQWNQRASVLIPLSLQHAIWGP
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggagtgcgcatcgaagaccttgtggtggtgcaaaattctaaagccacagtgttatgaa
gatcggggcaagcttgtttacacctcttgttttccggggtggtgtgggcgtagccatgca
tttaaaaatgcagtaactttaggaatagggagtaatgtgggcgattctaaaaaggttttt
cgggccttgtggggatggttggcacgccaccggttagtttcaagattatgctcttcacct
ctttatatcaaccctgcttttggctacacaaatcaaagggatttcacaaatgcaaccctc
tctttccaaacgcctttgagtgttgggcaactctttagcatgcttttttacttagaacgc
cgttggggcagggagcgcaaacgcccttttaaaaatgcccctagaactcttgacatcgat
ctgctcttttttaatcgcatggtttatagacaagattatctcactttgccccatccacaa
tggaatcaacgcgcctctgtattgattcctttaagcttgcaacatgccatttgggggcca
gcatga

DBGET integrated database retrieval system