KEGG   Helicobacter felis: HFELIS_14010Help
Entry
HFELIS_14010      CDS       T01375                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hfe  Helicobacter felis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HFELIS_14010 (galU)
   00052 Galactose metabolism
    HFELIS_14010 (galU)
   00500 Starch and sucrose metabolism
    HFELIS_14010 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HFELIS_14010 (galU)
Enzymes [BR:hfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HFELIS_14010 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1378375..1379196
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYGVEEAIEAGCQAMAIVTGRGKR
AIEDHFDISYELEHQISGTNKEQYLESIRAIMQTCSFSYTRQNEMKGLGHAIYTAQTLIG
NEPFCVVLADDLCLNQGPGVLKQMVELYGKYQCCIVAIEEVPMEEVHKYGVIKGQEIANG
VYQVIDMVEKPKPEQAPSNLAIIGRYILTPDIFSVLKHTKPGKNQEIQITDALLEQAQHK
QVLAYKFQGKRYDCGSMDGFIQATNDFYQLMRD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctcttccctgcggcaggttatggaacgcgcttcctgccggccaca
aaagcgatgccaaaggagatgttgcccattgtcaataaacccttaattcaatatggtgtt
gaggaggcgatagaggcagggtgtcaagccatggctattgttacaggaaggggcaagcgc
gccattgaggatcattttgatattagttatgagctagaacatcaaattagcggcacaaat
aaagaacaataccttgagagtatccgcgccattatgcaaacctgcagtttttcctatacc
cgtcaaaatgaaatgaagggtttagggcatgccatctacaccgctcaaactctcattggc
aatgaacctttctgtgtagttttggctgacgatctttgccttaatcaaggcccgggcgtg
cttaaacagatggtggagctctatggcaagtatcaatgttgcattgtggctatcgaggaa
gtgcccatggaggaagtgcacaaatatggtgtgatcaaggggcaagaaattgccaatgga
gtttatcaagtcatcgatatggtggaaaaacccaagccagagcaagcccctagtaatttg
gccatcattgggcgttatatcctcacacctgatatttttagcgtgctcaaacacaccaaa
ccggggaaaaatcaagagattcaaatcacagacgcgctcttagaacaggcccagcataaa
caagttttggcttataaatttcaaggtaaacgctatgattgtggcagtatggatggattc
atacaagccaccaacgatttttatcaacttatgagggattga

DBGET integrated database retrieval system