KEGG   Helicobacter felis: HFELIS_15420Help
Entry
HFELIS_15420      CDS       T01375                                 

Definition
thiamine-phosphate pyrophosphorylase
Orthology
K00788  
thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
hfe  Helicobacter felis
Pathway
Thiamine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:hfe00730]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1513851..1514465)
Genome map
AA seq 204 aa AA seqDB search
MGIELKGLYAISDPQLTPYDRLLNLAERAIEGGVSFLQLRDKQSSDSELLGLAKELNDLC
TKKGVGFVINDRLSLALECNAWGLHLGEADIPLSEARALFGGVIGVSCYGDLEKAKQAQA
QGADYVAFGACFRSPSKPSAPCIDLEVLERAKACLTIPVCAIGGISVQNVAQLKHADMIA
LISALWQGDVRTNAQKLLENWHAH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggaatagaacttaaaggcttgtatgcgatcagtgatccccaactcaccccctatgat
cgcctactcaatctagccgagcgcgccattgaggggggggtgagttttttgcaactgcgc
gataagcagagtagcgatagcgaacttttaggtttggctaaagaattaaacgatttatgt
accaaaaagggtgtgggttttgtgatcaatgatcgtctttctctagccctagagtgtaac
gcgtgggggttgcacttaggcgaggcagacatacccttaagcgaggcgcgcgcgctcttt
ggtggagtgatcggggtctcttgctatggagacttagaaaaagccaaacaagcccaagcg
cagggagcggattatgtcgcttttggggcgtgttttagatcgcctagcaagcctagcgca
ccttgtatagatttagaagtcttagagcgtgctaaggcgtgcttaacaatcccggtgtgt
gccatcggggggatcagcgtccaaaatgtcgctcaacttaaacacgcagatatgatcgca
ctcatcagcgcgctttggcagggtgatgtgcgcactaatgcgcaaaaattactagaaaat
tggcatgcgcattaa

DBGET integrated database retrieval system