KEGG   Heterocephalus glaber (naked mole rat): 101696584Help
Entry
101696584         CDS       T02812                                 

Definition
cocaine esterase-like
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101696584
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101696584
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     101696584
    3.1.1.84  cocaine esterase
     101696584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 553 aa AA seqDB search
MGLDQLLTLLRAVTCGLLILHPGQALDSASPIRSTNTGQVRGSLVHVKGTDVGVHTFLGI
PFAKPPVGSLRFAAPEAPEPWSGVRDGTSYPAMCLQDVDIMKMFNMTTPSVPVAEDCLYL
NIYTPAHVHDESRLPVMVWIHGGGLVVGMASLYDGSKLAASENVVVVTIQYRLGVLGFFS
TEDQHAAGNWGFLDQVAALRWVQQNIVHFGGNPDGVTIFGESAGGVSVSSLVLSPMSQGL
FHGAIMESGVALLPGIISSSSENIYTTVANVSGCGQIDSEAMVRCLRGKSEEEILAITKP
FKIIPAVVDGAFLPRHPQELLASADFQPVPSIIGVNSDEYGLVIPMFFGSTDTQKEMNRE
TLRTVLQSMSAQMMLPAEFGDLFMEEYIGDIKDPQALKIQFHEMMGDFMFMIPALQVAHF
HCSHGTVYFYEFQHPPDFLKNIRPPYMKADHGDEIPFVFGHFLWDNQVHFTEEEELLNRR
MMKYWANFARNGNPNGQGLPHWPALDHEELYLQLDINPTVGRALKAPRLKFWTETLPQKI
QELRRAEEKHAEL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggactggaccagcttctcaccttgctgagggctgtgacctgtgggctcttaattcta
catccaggccaagccctggactctgccagccccatccggagcacaaacactgggcaggtg
cggggcagcctcgtccacgtgaagggcactgatgtgggagtccacaccttcctgggaatt
ccatttgccaagccacctgtaggatcactgcggtttgcagcccctgaggcccctgagccc
tggagtggtgtgagggatggaacctcctaccctgctatgtgtctgcaagatgtggacata
atgaagatgtttaatatgaccactccttcagtccctgtagctgaggactgcctgtacctc
aacatctatacacctgcccatgtgcatgatgaatctcgcctgcctgtcatggtatggatc
catggtggtggactggttgtaggcatggcttccttatatgatggatccaaactggcagct
tctgagaatgtggtggtggtcactatccagtaccgcctgggtgtcctggggttcttcagc
actgaagaccagcatgccgctggtaactggggcttcctggaccaagtggctgccctacgc
tgggtgcaacagaatatagttcactttggaggcaaccctgatggggtcaccatatttggg
gagtctgcaggtggtgtaagcgtgtcgtcacttgtcttgtcccccatgtctcaaggactc
ttccatggtgccatcatggagagtggggtggccctgctgcctggtatcatctctagctca
tctgagaacatctacacaacggtggccaacgtgtctggctgtgggcagattgactcagaa
gccatggtgagatgcttacgtggcaagagtgaagaggagattttggctattacaaagccc
ttcaagatcatccctgctgtagtggatggggccttcctgcccaggcacccccaggagctg
ctggcctctgctgattttcaacccgtccctagcatcattggagtcaacagtgatgagtat
ggcttggttattcctatgtttttcggctctactgacacccagaaggaaatgaacagagag
actctgcggactgttctgcagagcatgtcagcacagatgatgttgcctgctgagtttggt
gacctgttcatggaagagtacattggggatattaaggacccccaggccctcaaaatccag
ttccatgagatgatgggggattttatgttcatgattcctgcactccaagtagcacatttt
cactgttcccatggcactgtctacttctatgaattccagcatcctcccgacttcctcaaa
aacatcaggccaccctacatgaaggcagaccatggcgatgagattccctttgtctttgga
catttcttgtgggacaaccaagtgcacttcactgaggaggaggagctactaaacagaagg
atgatgaaatattgggccaattttgcacgaaatgggaaccccaatggccagggtctgcct
cactggcctgcactggatcatgaggagctgtacctgcagctcgacatcaatcctactgtg
ggccgtgccctgaaggcccccaggctaaagttctggacggagacactgcctcagaagatc
caggagctaaggagggcagaggagaagcatgcagagctgtag

DBGET integrated database retrieval system