KEGG   Heterocephalus glaber (naked mole rat): 101696695Help
Entry
101696695         CDS       T02812                                 

Gene name
Uchl5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 328 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEPMDTDQGNNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLK
TLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggtgcccaagtagaagaaatatggagtttagagcct
gagaattttgaaaaattaaagccagttcatgggttaatttttcttttcaagtggcaacca
ggagaagaaccagcaggctctgtggttcaggactccagacttgacacaatattttttgcc
aagcaggtaattaataatgcttgtgctactcaagccattgtcagtgtcctgttgaactgt
acccatcaagatgtccatttaggagagacattgtcagagtttaaagaattttcacaaagt
tttgatgcagctatgaaaggtttggcattgagcaattcagatgtgattcgacaagtgcac
aacagttttgccagacaacaaatgtttgaattcgatgcaaagacatcagccaaagaagaa
gatgcttttcactttgtcagctatgttcctgttaatggaaggctatatgaattggatgga
ttaagagaaggaccgattgatttaggtgcatgcaatcaagatgactggattagtgcagta
aggccagtcatagaaaaaaggatacaaaagtacagtgaaggtgaaattcgatttaactta
atggccattgtgtctgacagaaaaatgatatacgaacagaagatagcagagttacaaaga
caacttgcagaggaacctatggataccgatcagggtaataatatgttaagtgctattcag
tcagaagttgccaaaaaccagatgcttattgaagaagaagtacaaaaattgaaaagatac
aagattgaaaatatcagaaggaagcacaattatctgccattcattatggaactgttaaag
actttagcagaacaccagcaattaataccacttgtagaaaaggcaaaagagaaacagaat
gcaaaaaaagctcaggaaactaaatga

DBGET integrated database retrieval system