KEGG   Heterocephalus glaber (naked mole rat): 101696726Help
Entry
101696726         CDS       T02812                                 

Definition
intestinal-type alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101696726
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101696726
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101696726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
MQGARALLLLLLLLGLRLQLTLGIIPEEENPAFWNQKGAEALAAAKKLQPIQTAAKNLIL
FLGDGMGVSTVTATRILKGQMQGQPGPETTLAMDRFPYMALSKTYNVDRQVPDSAGTSTA
YLCGIKTNFQTIGLSAAARYNNCSTERGNEVKSVMYWAEKAGKSVGIVTTTTVQHASPAG
TYAHTVNRNWYSDADMPASARQEGCRDIATQLVSNMDIDVILGGGRKYMFPRGTPDPEYP
SNTAQGGARQDGKDLVQEWLSKHEDSQYVWNRTELLRVSQDPSVTRLMGLFEPGHLAYET
YRDPELDPSLAEMTAVAVRVLSRNPRGFFLFVEGGRIDHGHHETIAYRALTEAVMFDSAI
DKAGQLTSEQDTLTLITADHSHVFTFGGYTLRGTSIFGLSPEKAKDGKAYTSILYGNGPN
FKNPRADVTAQESGSPTYRQPAAVPLSSETHSGEDVAVFARGPQAHLMHGVQEQSYIAHL
MAFAGCLEPYTACGLLPPGQRGDQTGDKSSAAPSLSPSLVAWTLVLLLGSTAL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagcccgggcactgctgctgctgctcctgctgctgggcctgaggttacagctg
acccttggcatcatcccagaggaggagaacccagccttctggaaccaaaagggggccgag
gccttggcagctgctaagaagctacagcccattcagactgcggccaagaacctcatcctc
ttcctgggggacgggatgggggtgtccacggtgactgccaccaggatcctgaaggggcag
atgcagggtcagcctgggccagagacaactctggccatggatcgattcccatacatggcg
ctgtccaagacatacaacgtggacagacaggtgccggacagtgcaggcacttccaccgcg
tacctgtgtggcatcaagaccaacttccagaccatcggcctgagcgctgccgcccgctac
aacaactgcagcacagagaggggcaacgaggtcaagtctgtgatgtactgggccgagaaa
gcagggaagtctgtcggaatcgtgaccaccactacagtccagcacgcctcgccggcaggc
acctatgcacacaccgtgaaccgcaactggtactcggacgccgacatgcccgcctcagcg
cgccaggagggctgccgggacatcgccacgcagctcgtctccaacatggacattgacgtg
atcctgggcgggggccgcaagtacatgttccccagggggaccccggaccccgagtaccca
agtaacactgcccagggaggagccaggcaggacgggaaggacctggtgcaggagtggctg
tccaagcacgaggactctcagtacgtgtggaaccgcacagagctgctccgggtgtcccag
gacccgtccgtgacccgcctcatgggcctatttgaacctggacacttggcgtatgaaacc
taccgagaccctgagctggacccctccctggcggagatgacagcggtggcggtgcgcgtg
ctgagcaggaacccccgtggtttcttcctctttgtggaggggggccgcatcgaccacggc
caccacgagaccatagcctaccgagcactcaccgaggcggtcatgttcgactccgccatc
gacaaggccgggcagctcaccagcgagcaggacaccctgaccctcatcaccgccgaccac
tcccacgtcttcacgttcgggggctacaccctgcgggggacctccatcttcgggctgtca
ccggagaaggccaaagacggcaaagcctacacctccatcctgtacggaaacggcccgaac
ttcaagaacccgcgggcagatgtcaccgcccaggagagtggctcccccacataccggcag
cccgccgctgtgcccctgagctccgagacccacagcggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctcatgcacggcgtgcaggagcagagctacatcgcgcacctc
atggccttcgccggctgcctggagccctacaccgcctgcggcctgctgccgcctggccag
agaggtgaccagacaggtgacaagagcagcgctgcccccagcctctcgccgtctctggtg
gcctggacactggtgctgctgctggggtccaccgcgctctga

DBGET integrated database retrieval system