KEGG   Heterocephalus glaber (naked mole rat): 101698110Help
Entry
101698110         CDS       T02812                                 

Definition
sperm acrosome-associated protein 5-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 159 aa AA seqDB search
MQFLGTVIVILSILMAPNVDAKIFEHCELAKKLEKAGLNSYKGYSIRDWLCMAHYKSGFD
TSFVDHNPDGSSEYGIFQLNSAWCDNGITPTKNFCHMDCQDLLNHHILDDITCAKLIVYS
KNSMNAWDSWSQHCSGHDLSEXFKGCDVNMKTDSMKINS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcttaggcacagtgatagtgatcttgtccatattgatggctcccaacgtggac
gccaagatttttgaacactgtgaactagcaaagaagctggagaaggcaggcctcaacagc
tacaaaggctacagcatcagagactggttgtgcatggcacactacaagagtggctttgac
acctccttcgtggaccacaatcctgacggcagcagtgaatatggcatttttcagctgaac
tccgcctggtgtgacaatggcatcacacccaccaagaacttttgccacatggattgtcaa
gatctgctcaaccaccatattctggatgatatcacatgtgccaagctgatagtgtattct
aagaatagtatgaatgcctgggattcgtggagccagcactgttctggccatgatttatct
gaatagttcaaaggatgtgatgtgaatatgaaaactgactcaatgaaaattaattcatga

DBGET integrated database retrieval system