KEGG   Heterocephalus glaber (naked mole rat): 101699130Help
Entry
101699130         CDS       T02812                                 

Gene name
Gpt2
Definition
(RefSeq) glutamic--pyruvic transaminase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00220  Arginine biosynthesis
hgl00250  Alanine, aspartate and glutamate metabolism
hgl01100  Metabolic pathways
hgl01200  Carbon metabolism
hgl01210  2-Oxocarboxylic acid metabolism
hgl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101699130 (Gpt2)
   00220 Arginine biosynthesis
    101699130 (Gpt2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101699130 (Gpt2)
Amino acid related enzymes [BR:hgl01007]
 Aminotransferase (transaminase)
  Class I
   101699130 (Gpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101699130
NCBI-ProteinID: XP_004873947
Position
Un
AA seq 518 aa AA seqDB search
MQRAAALARKGCCPRTAGAWGRRWSSAAAEAPAVLRARRGRILTPESMNPQVRAVEYAVR
GPIVLKAVEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSP
SFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGMPADPDNIYLTT
GASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNV
HELRRAVREAKNHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDN
VYSPDCRFHSFKKVLYEMGPEYSNNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKG
QLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFHKEKESVLGNLATKAKLTENLFN
EVPGIHCNPLQGAMYAFPRIFIPTKAVEAAQAHKMAPDMFYCMKLLEETGICVVPGSGFG
QREGTYHFRMTILPPVEKLKTVLQKVKDFHIKFLDKYA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcggcggccctggcccgcaagggctgctgtccccgcaccgcgggcgcctgg
ggccgccgttggagcagcgcggccgccgaggccccagccgtgctccgggcgcggcgcggg
cgcatcctcaccccagagtccatgaacccgcaggtgcgcgcggtggagtacgccgtgcgg
gggcccatcgtgctcaaggccgtcgagatagagctcgagctgcagcggggtatcaagaaa
ccattcactgaggtcattcgagccaacatcggggatgcccaagccatgggccagcagcca
atcacctttctccgtcaggtgatggccctgtgcacctacccaaacctgttggacagcccc
agtttcccagaagatgctaagaaaagagcccggcggattctacaggcttgtggcggaaac
agcctagggtcatacagtgccagccaaggtgtcaactgcatccgtgaagatgtggctgcc
tacatcaccaggagagatggtggcatgccggcggacccagacaacatttatctgaccact
ggagctagtgatggcatttctacaatcctgaagatccttgtctctgggggtggcaagtct
cgaacgggtgtgatgatccccatcccacagtatcccctctactcagcggtcatctcggag
ctcgatgccatccaggtgaattactacctggacgaggagaactgctgggccctgaatgtg
cacgaactccggcgggctgtgcgagaggccaaaaaccactgtgaccccaaagtgctctgc
atcatcaacccagggaaccccacaggccaggtacaaagcagaaagtgcatagaagatgtg
attcactttgcctgggaagagaagctctttctcctggctgatgaggtgtaccaggacaac
gtgtactctccagactgcagattccactcctttaagaaggtgctttatgagatgggacct
gagtattccaacaatgtggaacttgcctccttccactctacctccaagggctacatgggc
gaatgtggctaccgtggaggctacatggaggtgatcaacctgcaccccgagatcaagggc
cagctggtgaagctgctctcagtgcgtctgtgcccgcctgtgtctggacaggccgccatg
gacatcgtcgtgaaccctccagtggcaggggaggagtccttcgagcagttccacaaggag
aaggagtccgtcctgggtaacctggccacaaaagcaaagctgacagaaaacctgtttaac
gaagtcccaggaattcactgcaaccccttgcagggcgccatgtatgcctttcctcggatc
ttcattcccaccaaggctgtggaagcagctcaggcccataaaatggctccagacatgttt
tactgcatgaagctcctggaggagaccggcatctgcgttgtgcctggcagtggctttggg
cagagggaaggcacttaccacttcagaatgaccatcctccctccagtggagaagctgaag
acagtgctccagaaggtgaaggactttcacataaagttcctggacaagtacgcctga

DBGET integrated database retrieval system