KEGG   Heterocephalus glaber (naked mole rat): 101699130Help
Entry
101699130         CDS       T02812                                 

Gene name
Gpt2
Definition
glutamic pyruvate transaminase (alanine aminotransferase) 2
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hgl01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hgl01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hgl01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hgl00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 518 aa AA seqDB search
MQRAAALARKGCCPRTAGAWGRRWSSAAAEAPAVLRARRGRILTPESMNPQVRAVEYAVR
GPIVLKAVEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSP
SFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGMPADPDNIYLTT
GASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNV
HELRRAVREAKNHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDN
VYSPDCRFHSFKKVLYEMGPEYSNNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKG
QLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFHKEKESVLGNLATKAKLTENLFN
EVPGIHCNPLQGAMYAFPRIFIPTKAVEAAQAHKMAPDMFYCMKLLEETGICVVPGSGFG
QREGTYHFRMTILPPVEKLKTVLQKVKDFHIKFLDKYA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcggcggccctggcccgcaagggctgctgtccccgcaccgcgggcgcctgg
ggccgccgttggagcagcgcggccgccgaggccccagccgtgctccgggcgcggcgcggg
cgcatcctcaccccagagtccatgaacccgcaggtgcgcgcggtggagtacgccgtgcgg
gggcccatcgtgctcaaggccgtcgagatagagctcgagctgcagcggggtatcaagaaa
ccattcactgaggtcattcgagccaacatcggggatgcccaagccatgggccagcagcca
atcacctttctccgtcaggtgatggccctgtgcacctacccaaacctgttggacagcccc
agtttcccagaagatgctaagaaaagagcccggcggattctacaggcttgtggcggaaac
agcctagggtcatacagtgccagccaaggtgtcaactgcatccgtgaagatgtggctgcc
tacatcaccaggagagatggtggcatgccggcggacccagacaacatttatctgaccact
ggagctagtgatggcatttctacaatcctgaagatccttgtctctgggggtggcaagtct
cgaacgggtgtgatgatccccatcccacagtatcccctctactcagcggtcatctcggag
ctcgatgccatccaggtgaattactacctggacgaggagaactgctgggccctgaatgtg
cacgaactccggcgggctgtgcgagaggccaaaaaccactgtgaccccaaagtgctctgc
atcatcaacccagggaaccccacaggccaggtacaaagcagaaagtgcatagaagatgtg
attcactttgcctgggaagagaagctctttctcctggctgatgaggtgtaccaggacaac
gtgtactctccagactgcagattccactcctttaagaaggtgctttatgagatgggacct
gagtattccaacaatgtggaacttgcctccttccactctacctccaagggctacatgggc
gaatgtggctaccgtggaggctacatggaggtgatcaacctgcaccccgagatcaagggc
cagctggtgaagctgctctcagtgcgtctgtgcccgcctgtgtctggacaggccgccatg
gacatcgtcgtgaaccctccagtggcaggggaggagtccttcgagcagttccacaaggag
aaggagtccgtcctgggtaacctggccacaaaagcaaagctgacagaaaacctgtttaac
gaagtcccaggaattcactgcaaccccttgcagggcgccatgtatgcctttcctcggatc
ttcattcccaccaaggctgtggaagcagctcaggcccataaaatggctccagacatgttt
tactgcatgaagctcctggaggagaccggcatctgcgttgtgcctggcagtggctttggg
cagagggaaggcacttaccacttcagaatgaccatcctccctccagtggagaagctgaag
acagtgctccagaaggtgaaggactttcacataaagttcctggacaagtacgcctga

DBGET integrated database retrieval system