KEGG   Heterocephalus glaber (naked mole rat): 101699446Help
Entry
101699446         CDS       T02812                                 

Gene name
Glud1
Definition
glutamate dehydrogenase 1
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Proximal tubule bicarbonate reclamation
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:hgl00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hgl00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hgl00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:hgl00471]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hgl04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 558 aa AA seqDB search
MYRRLGEALLLSRGGPSATDPAALFGCWARAPPVVAPPPALGTPAYRRYSDAAAEREDDP
NFFKMVEGFFDRGANIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSVSFPIRR
DDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKA
GVKINPKNYSDSELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTYASTI
GHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTF
VVQGFGNVGLHSMRYLHRFGAKCVAVGESDGSIYNPDGIDPKELEDFKLQHGSILGFPKA
RVYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMV
IPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGT
IPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARVCHKCHLPSYYWHKAPLHSPVLTGG
LWGRIENSNCSPGPAYVQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgccgcctgggcgaggcgctgctcctgtcccgcggtgggccctccgccaccgac
cccgcagctctgttcggctgctgggcccgcgcgcctcctgtcgtcgccccaccgccagcc
ctcgggacgcctgcctaccgccgctacagcgatgcggcggccgagcgcgaggacgacccc
aatttcttcaagatggtggagggcttcttcgaccgcggcgccaacatcgtggaggacaag
ctcgtggaggacctgcgcacccgcgagagcgaggagcagaagcgcaaccgcgtgcgcggc
atcttgcgcattatcaagccctgcaaccacgtgctgagcgtctccttccccatccggcgc
gacgacggttcctgggaggtcatcgagggctacagagcccagcacagccagcaccgcaca
ccctgcaagggaggcatccggtacagcaccgatgtgagtgtggatgaagtgaaggcgctg
gcctcactgatgacgtacaagtgtgcagtggttgatgtgccatttggtggagctaaagca
ggtgttaagatcaaccccaaaaactattcagacagtgaattggaaaagatcacaagaaga
ttcaccatggagctagcaaagaagggttttattggtcctggcattgacgtgcctgcccca
gacatgagcacaggcgagcgggagatgtcctggatcgcagacacctatgccagcaccata
gggcactatgacattaatgcacatgcctgtgttaccgggaagcccatcagtcaaggggga
atccatgggcggatctctgcaactggccgaggggttttccatgggattgagaacttcatc
aatgaagcttcttacatgagcattttaggaatgacacccggctttggagataaaacattt
gttgttcagggctttggtaatgtggggctgcactctatgagatatttacatcgttttggt
gctaaatgtgttgctgttggggagtctgatgggagcatatataatccagatggtattgac
ccaaaagaactggaagatttcaagttgcaacatggatcaattctgggcttccctaaggca
agggtatatgaaggaagcatcttggaggctgactgcgacatcctgatccctgctgccagt
gagaagcaattgaccaaatccaacgcacccagagtcaaagccaaaatcatcgctgaaggt
gccaatggacccaccactccagaagctgataagattttcctggagaggaacatcatggtt
attccagatctctacttgaatgctggaggagtgacagtatcttactttgagtggctgaag
aatctaaatcatgtcagctatggccgattgaccttcaaatatgaaagggattctaactac
cacttgctgatgtctgttcaagaaagcttagaaagaaaatttgggaagcatggcgggaca
attcctatcgtcccaacagcagagttccaggacaggatatcgggggcatcagagaaagac
atcgtccactccggcttagcctacacgatggagcgttctgccagggtatgtcacaagtgc
catctgccttcctactattggcacaaagcaccactccactccccagtgctcacgggcggg
ttgtggggaaggatagaaaacagcaactgttcacctggccctgcctatgtgcagtga

DBGET integrated database retrieval system