KEGG   Heterocephalus glaber (naked mole rat): 101699446Help
Entry
101699446         CDS       T02812                                 

Gene name
Glud1
Definition
glutamate dehydrogenase 1
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    101699446 (Glud1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101699446 (Glud1)
   00330 Arginine and proline metabolism
    101699446 (Glud1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101699446 (Glud1)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101699446 (Glud1)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101699446 (Glud1)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101699446 (Glud1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 558 aa AA seqDB search
MYRRLGEALLLSRGGPSATDPAALFGCWARAPPVVAPPPALGTPAYRRYSDAAAEREDDP
NFFKMVEGFFDRGANIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSVSFPIRR
DDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKA
GVKINPKNYSDSELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTYASTI
GHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTF
VVQGFGNVGLHSMRYLHRFGAKCVAVGESDGSIYNPDGIDPKELEDFKLQHGSILGFPKA
RVYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMV
IPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGT
IPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARVCHKCHLPSYYWHKAPLHSPVLTGG
LWGRIENSNCSPGPAYVQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgccgcctgggcgaggcgctgctcctgtcccgcggtgggccctccgccaccgac
cccgcagctctgttcggctgctgggcccgcgcgcctcctgtcgtcgccccaccgccagcc
ctcgggacgcctgcctaccgccgctacagcgatgcggcggccgagcgcgaggacgacccc
aatttcttcaagatggtggagggcttcttcgaccgcggcgccaacatcgtggaggacaag
ctcgtggaggacctgcgcacccgcgagagcgaggagcagaagcgcaaccgcgtgcgcggc
atcttgcgcattatcaagccctgcaaccacgtgctgagcgtctccttccccatccggcgc
gacgacggttcctgggaggtcatcgagggctacagagcccagcacagccagcaccgcaca
ccctgcaagggaggcatccggtacagcaccgatgtgagtgtggatgaagtgaaggcgctg
gcctcactgatgacgtacaagtgtgcagtggttgatgtgccatttggtggagctaaagca
ggtgttaagatcaaccccaaaaactattcagacagtgaattggaaaagatcacaagaaga
ttcaccatggagctagcaaagaagggttttattggtcctggcattgacgtgcctgcccca
gacatgagcacaggcgagcgggagatgtcctggatcgcagacacctatgccagcaccata
gggcactatgacattaatgcacatgcctgtgttaccgggaagcccatcagtcaaggggga
atccatgggcggatctctgcaactggccgaggggttttccatgggattgagaacttcatc
aatgaagcttcttacatgagcattttaggaatgacacccggctttggagataaaacattt
gttgttcagggctttggtaatgtggggctgcactctatgagatatttacatcgttttggt
gctaaatgtgttgctgttggggagtctgatgggagcatatataatccagatggtattgac
ccaaaagaactggaagatttcaagttgcaacatggatcaattctgggcttccctaaggca
agggtatatgaaggaagcatcttggaggctgactgcgacatcctgatccctgctgccagt
gagaagcaattgaccaaatccaacgcacccagagtcaaagccaaaatcatcgctgaaggt
gccaatggacccaccactccagaagctgataagattttcctggagaggaacatcatggtt
attccagatctctacttgaatgctggaggagtgacagtatcttactttgagtggctgaag
aatctaaatcatgtcagctatggccgattgaccttcaaatatgaaagggattctaactac
cacttgctgatgtctgttcaagaaagcttagaaagaaaatttgggaagcatggcgggaca
attcctatcgtcccaacagcagagttccaggacaggatatcgggggcatcagagaaagac
atcgtccactccggcttagcctacacgatggagcgttctgccagggtatgtcacaagtgc
catctgccttcctactattggcacaaagcaccactccactccccagtgctcacgggcggg
ttgtggggaaggatagaaaacagcaactgttcacctggccctgcctatgtgcagtga

DBGET integrated database retrieval system