KEGG   Heterocephalus glaber (naked mole rat): 101699800Help
Entry
101699800         CDS       T02812                                 

Gene name
Gys2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101699800 (Gys2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101699800 (Gys2)
   04152 AMPK signaling pathway
    101699800 (Gys2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101699800 (Gys2)
   04922 Glucagon signaling pathway
    101699800 (Gys2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101699800 (Gys2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101699800 (Gys2)
Glycosyltransferases [BR:hgl01003]
 Polysaccharide
  Storage polysaccharide
   101699800 (Gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 712 aa AA seqDB search
MLRGRSLSVTSLSGFPQWEADKLPVEDLLLFEVSWEVTNKVGGICTVIQTKAKTTADEWG
ENYFLIGPHFEHNMKTQVEPCEPLNAAVRRAMDAMNKHGCQVRFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDFWEACSVGIPHHDREANDMLIFGSLTAWFLKEVTDHADGQHVIAHFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANADFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRLSYFLI
SHQMHKSNITVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHSMKEKFGKKLYDALLRG
EIPDMNNILDRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRLGLFNSRSD
RVKIILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNL
SGFGCFVQEHVADPTAYGIYIVDRRFCSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTER
LSDLLDWRYLGRFYQHARHLTLSRAFPDNFHMELMSLPMTDGFKYPRPSSVPPSPLGSQA
SSPQSSDVEDENEDERYDEEEEAERDRLNIKSPFYLSHVPHGKKKLHGEYKN
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatccttatctgtgacatccctgagcgggtttccccagtgggaagct
gacaaacttcctgtggaggatttgctgctctttgaagtttcttgggaggtgaccaataaa
gttggagggatctgtactgtgattcagacaaaggccaagacgacagcagatgagtggggt
gaaaactactttctgataggcccacattttgagcacaatatgaagactcaggtggaaccg
tgtgaaccgttgaacgcagctgtccgacgagcgatggacgccatgaataagcacggctgc
caggtgcgtttcggaaggtggctgatagaagggagtccctatgtggtgctctttgacatt
ggctactctgcctggaacctggacagatggaagggcgacttctgggaagcgtgcagtgtt
ggcatccctcatcacgaccgggaagccaatgacatgctcatatttgggtctttaactgcc
tggttcttaaaagaggtgacggaccatgcagatggtcaacatgttattgcccatttccat
gaatggcaggctggaactgggctgattctttctcgagcccggaaactccctattgccaca
atatttacaacccacgccacattacttgggaggtatctgtgtgcagcaaatgctgatttc
tacaaccacctggataagtttaacattgacaaagaggccggggaaaggcagatttaccac
cgctactgcatggagcgggcatctgttcattgtgctcatgtattcaccacagtttctgaa
ataacagcaattgaggcagaacatatgctgaagagaaagcctgatgtagttactccaaat
ggcttgaatgttaagaagttttcagcagtgcatgaatttcaaaatctgcatgccatgtac
aaggccaggatccaagattttgttcgaggtcatttctatggtcatcttgactttgatctg
gaaaagactttattccttttcattgcggggagatatgagttttcaaacaaaggagctgac
atcttcctagaatccttatctagactaaacttcttgctgaggctgtcgtattttctaatc
tctcatcagatgcataaaagtaacatcaccgtggtggtgtttttcattatgcctgccaag
acaaacaatttcaatgtggaaaccctaaaaggacaagcagtgcggaagcagctatgggac
actgtacattcaatgaaggaaaagtttggaaagaaactctatgatgcattgttaagagga
gaaattcctgacatgaataatattttggatcgagatgacctaacaattatgaaaagagcc
atcttttcaacacagcgacaatctctgccaccggtgacaactcacaacatgattgatgac
tccacagaccctattctcagcaccattaggcggctcgggcttttcaacagccgctcagac
agagtcaagataattttgcacccagagtttttgtcttccaccagtcccctgttgcccatg
gattatgaggagttcgtgcgaggttgtcatcttggtgtgttcccatcatactatgaaccc
tggggttacactccggccgagtgcactgtgatgggcatccccagtgtgaccacaaacctc
tctggctttggttgtttcgtgcaggagcacgtggctgatccaactgcttacggtatttac
attgttgacaggcggttctgctctccagatgattcttgtaatcagctgactcagtttctt
tatggattttgcaaacaatcacgccgccaaagaatcatccagaggaaccggacggagaga
ctctcagatcttctggactggagatacttaggcagattttaccagcatgctaggcatctg
actttaagcagagcttttcccgacaattttcacatggaactcatgtcactaccaatgaca
gatgggtttaagtatcccaggccttcctcagtaccaccctctccgttggggtctcaggcc
tccagtcctcagagcagcgatgtggaagatgaaaatgaagatgagcgatatgatgaggaa
gaggaggctgaaagggatcggttaaatattaagtctcccttttatctgagccatgttcct
catgggaagaaaaagctgcatggtgaatacaagaactga

DBGET integrated database retrieval system