KEGG   Heterocephalus glaber (naked mole rat): 101700701Help
Entry
101700701         CDS       T02812                                 

Definition
cytochrome P450 11B2, mitochondrial-like
Orthology
K00497  
steroid 11beta-monooxygenase [EC:1.14.15.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101700701
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     101700701
Cytochrome P450 [BR:hgl00199]
 Cytochrome P450, animal type
  CYP11 family
   101700701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 503 aa AA seqDB search
MGMAFRVKADVWLAGPWLCLRGARALGTRAVMPPMAMVLPFEAIPQCPGNKWLRVLQIWK
DQGVEDIHLEMHRTFQELGPIFRYDVGRMQIVSVMLPEDAEQLHQAESLYPCRMHLEPWM
AYREHRGQKPGVFLLNGPEWRSNRLQLNPNVLSPKAVQKFLPMVNIVARDFSEALKKKVL
QSAQRILTLDIQPSIFNYTVEASNFALFGERLGLFGHNPSSDSLNFIHALEVMLKSTGQL
MFLPRHLSRLMSSQVWKEHFEAWDHIFDYADNWIQKTYQKLVCGCPQYYNGIMTDLLLQG
NLPLNSIKANSIELTAGSVDTTTYPIMMTLFELARNPTVQQALHQESLAAEPSISGNPQR
ATMELPLLRAALKETLRLYPVGLFLERILSSDLVLQNYHLPAGTLVHLYLYSMGRNPSVF
PSPERYNPQRWLDSRQTFHHLAFGFGVRQCLGRRLAEVEMLLFLHHILKSFHVETPLQED
VKLAYNFVLMPTTFPPLTFRAVT
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggggatggcattcagggtgaaggcagacgtgtggctggcagggccctggctgtgcctg
agaggggccagggcactgggcaccagagcagttatgccccccatggccatggtgctgccc
tttgaagccataccccaatgtccaggcaacaagtggttgagggtgctgcagatttggaag
gatcaaggcgttgaggacattcacctggagatgcatcgaaccttccaggagctggggccc
atttttaggtatgacgttggaaggatgcagatagtctctgtgatgctgccagaggatgct
gagcagctgcaccaagcagagagcctgtatccctgccgcatgcacctggagccctggatg
gcctacagagaacaccgagggcagaagcctggagtattcttgctgaatgggcctgaatgg
cgctctaaccgactgcagctgaacccaaatgtgctgtccccaaaggcagtgcaaaagttc
ctccccatggtgaacatagtggcaagagacttctcagaggccttgaagaagaaggtgcta
cagagtgcccagcggatcctgaccctggacatccagcccagcatttttaactatactgta
gaagccagcaactttgcactttttggagagaggttgggcctctttggccataacccaagc
tctgatagcctgaacttcatccatgccctggaggtcatgctcaaatccactgggcagctc
atgttcctgcccaggcatctatcccgcttgatgagcagccaggtgtggaaggagcacttt
gaggcctgggaccacatctttgactatgctgacaattggattcagaagacttatcagaaa
cttgtttgtggttgccctcagtactataacggcatcatgacagatcttctgttgcagggg
aacttgccactaaattccatcaaggctaacagtattgaactcacagcagggagtgtggac
acgaccacctacccaataatgatgacgctctttgagttggccaggaaccccacggtgcag
caggccctgcaccaggaaagcctggctgctgagcccagcatctcagggaatcctcagagg
gctaccatggaactgcccctgcttcgagcagccctcaaggagaccctgaggctgtaccct
gtcggtctttttctggagagaatcctgagctcagacttggtgcttcagaactaccacctc
ccggctgggaccttggtccatttgtatctgtattcaatgggccgaaacccctcagtgttc
ccgagtccagagcgctataacccgcaacgctggctggacagcaggcagaccttccatcac
ctggcttttggctttggggtgcgccagtgtctggggcggcgtctggcagaagtggagatg
ctgctgtttctgcatcacattctgaaatccttccacgtggagacaccgctccaagaggat
gtgaagttggcctacaactttgttttgatgcccaccaccttcccccccctcactttccgg
gctgtcacctag

DBGET integrated database retrieval system