KEGG   Heterocephalus glaber (naked mole rat): 101702833Help
Entry
101702833         CDS       T02812                                 

Gene name
Tk1
Definition
thymidine kinase 1, soluble
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hgl00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hgl00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 232 aa AA seqDB search
MSCINLPSVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSGFSTHDRNTMEALPACLLRDTAQEALGAAVIGIDEGQFFPDIVEFCEGMANAGKTVI
VAALDGTFQRKAFGSILNLVPLAESVVKLTAVCMECFREAAYTKRLGLEKEVEVIGGADK
YHSVCRLCYFKKSSVQNAGLDNKENCPVLPGEASVARKLFAPQQVLQCGPAI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacctgccctcagtgctgcccggctcccccagcaagacccggggccaa
atccaggtgattctcgggcccatgttctcagggaaaagcaccgagctgatgaggcgggtc
cgccgcttccagatcgcgcagtacaagtgcctggtcattaagtacgccaaagacacgcgc
tacagcagcggcttctccacacatgacaggaacactatggaggcgctgccagcctgcctg
ctccgggacacagcccaggaggccctgggagcggccgtcataggcattgacgaggggcag
tttttccctgacattgtggagttctgcgagggcatggccaatgccgggaagacagtgatc
gtggcggccctggacgggacctttcagaggaaggctttcggcagcatcctgaacctggtg
cccttggctgagagcgtggtgaagctgaccgctgtgtgcatggagtgcttccgggaagcc
gcctacaccaagaggctgggcctggagaaggaggtcgaggtgattggtggagcagacaaa
taccactccgtgtgtcgcctctgctacttcaagaagtcctcggtccagaatgctgggctg
gacaacaaggagaactgcccagtgctgccgggggaggcctcagtggccaggaagctcttt
gcccctcagcaggtgctgcagtgtggccctgccatctga

DBGET integrated database retrieval system