KEGG   Heterocephalus glaber (naked mole rat): 101702833Help
Entry
101702833         CDS       T02812                                 

Gene name
Tk1
Definition
thymidine kinase 1, soluble
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101702833 (Tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101702833 (Tk1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101702833 (Tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 232 aa AA seqDB search
MSCINLPSVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSGFSTHDRNTMEALPACLLRDTAQEALGAAVIGIDEGQFFPDIVEFCEGMANAGKTVI
VAALDGTFQRKAFGSILNLVPLAESVVKLTAVCMECFREAAYTKRLGLEKEVEVIGGADK
YHSVCRLCYFKKSSVQNAGLDNKENCPVLPGEASVARKLFAPQQVLQCGPAI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacctgccctcagtgctgcccggctcccccagcaagacccggggccaa
atccaggtgattctcgggcccatgttctcagggaaaagcaccgagctgatgaggcgggtc
cgccgcttccagatcgcgcagtacaagtgcctggtcattaagtacgccaaagacacgcgc
tacagcagcggcttctccacacatgacaggaacactatggaggcgctgccagcctgcctg
ctccgggacacagcccaggaggccctgggagcggccgtcataggcattgacgaggggcag
tttttccctgacattgtggagttctgcgagggcatggccaatgccgggaagacagtgatc
gtggcggccctggacgggacctttcagaggaaggctttcggcagcatcctgaacctggtg
cccttggctgagagcgtggtgaagctgaccgctgtgtgcatggagtgcttccgggaagcc
gcctacaccaagaggctgggcctggagaaggaggtcgaggtgattggtggagcagacaaa
taccactccgtgtgtcgcctctgctacttcaagaagtcctcggtccagaatgctgggctg
gacaacaaggagaactgcccagtgctgccgggggaggcctcagtggccaggaagctcttt
gcccctcagcaggtgctgcagtgtggccctgccatctga

DBGET integrated database retrieval system