KEGG   Heterocephalus glaber (naked mole rat): 101702892Help
Entry
101702892         CDS       T02812                                 

Gene name
Uchl1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    101702892 (Uchl1)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101702892 (Uchl1)
Peptidases [BR:hgl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101702892 (Uchl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 223 aa AA seqDB search
MQLKPMEINPEILNKVLSRLGVAGQWRFADVLGLEDEALGSVPAPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNRDKLEFEDGSVLKQFLSE
TEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGTSSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAT
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagcccatggagatcaaccccgagatactgaacaaagtgctgtcgcggcta
ggggtggccggccagtggcgcttcgccgacgtgctagggctggaggacgaggctctgggc
tcggtgccagcgccggcctgcgcgctgctgctgctgtttcccctcaccgcccagcatgag
aacttcaggaaaaaacagattgaagaactgaaaggacaagaagtgagtcccaaagtgtat
ttcatgaagcagaccattggaaactcctgtggtaccatcggactgatccacgcagtggcc
aataaccgagacaaactggaatttgaggatggatcggtcctgaaacagtttctttctgaa
acagagaagatgtcccctgaagacagagcaaagtgctttgaaaagaatgaggccatccag
gcagcccacgatgccgtggcccaggaaggccagtgtcgggtagatgacaaagtgaatttt
cattttattctgtttaacaacgtggatggccacctctatgaactggatggacgaatgcct
tttccagtgaaccatggcaccagttcagaggactctctgctgcaggacgccgccaaggtc
tgcagagagttcaccgagcgcgaacaaggagaagtccgcttctctgctgtggcactctgc
aaggcaacctag

DBGET integrated database retrieval system